BLASTP 2.2.21 [Jun-14-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0020.0372.p (62 letters) Database: COGmodified 192,987 sequences; 59,019,183 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value RSc2531 [S] COG2835 Uncharacterized conserved protein Rso Ralsto... 82 2e-16 CC0108 Non COG 76 2e-14 VC1876 [S] COG2835 Uncharacterized conserved protein Vch Vibrio ... 72 3e-13 STM0987 [S] COG2835 Uncharacterized conserved protein Sty Salmon... 72 4e-13 BMEII0403 [S] COG2835 Uncharacterized conserved protein Bme Bruc... 72 4e-13 ycaR [S] COG2835 Uncharacterized conserved protein Eco Escherich... 71 7e-13 ZycaR [S] COG2835 Uncharacterized conserved protein EcZ Escheric... 71 7e-13 ECs1000 [S] COG2835 Uncharacterized conserved protein Ecs Escher... 71 7e-13 YPO1399 [S] COG2835 Uncharacterized conserved protein Ype Yersin... 68 4e-12 msl4429 [S] COG2835 Uncharacterized conserved protein Mlo Mesorh... 67 7e-12 >RSc2531 [S] COG2835 Uncharacterized conserved protein Rso Ralstonia solanacearum Length = 62 Score = 82.4 bits (202), Expect = 2e-16, Method: Compositional matrix adjust. Identities = 39/62 (62%), Positives = 47/62 (75%), Gaps = 1/62 (1%) Query: 1 VNARLLDILVCPLCKGPLDYDKKAQELICKADKLAYPIRDGIPIMWADEARE-LTAAPAA 59 ++ RLL+ILVCPLCKG L +D+ ELIC DKLAYPIRDGIP+M ADEAR+ + P Sbjct: 1 MDNRLLEILVCPLCKGTLQHDRAHNELICHVDKLAYPIRDGIPVMLADEARQTVEGTPVD 60 Query: 60 PA 61 PA Sbjct: 61 PA 62 >CC0108 Non COG Length = 65 Score = 76.3 bits (186), Expect = 2e-14, Method: Compositional matrix adjust. Identities = 34/55 (61%), Positives = 44/55 (80%) Query: 1 VNARLLDILVCPLCKGPLDYDKKAQELICKADKLAYPIRDGIPIMWADEARELTA 55 V+ RLL++LVCP+ +GPL+YD+ ELI +A KLAYPIRDG+PIM +EAREL Sbjct: 11 VDPRLLEVLVCPVTRGPLEYDRAKGELISRAAKLAYPIRDGVPIMLPEEARELEG 65 >VC1876 [S] COG2835 Uncharacterized conserved protein Vch Vibrio cholerae Length = 59 Score = 72.0 bits (175), Expect = 3e-13, Method: Compositional matrix adjust. Identities = 31/54 (57%), Positives = 43/54 (79%) Query: 1 VNARLLDILVCPLCKGPLDYDKKAQELICKADKLAYPIRDGIPIMWADEARELT 54 ++ RLL+I+ CP+CKG L YDK QELICK D+LAYPI++GIP++ EAR ++ Sbjct: 1 MDHRLLEIVACPVCKGKLTYDKDRQELICKLDRLAYPIKEGIPVLLEPEARSMS 54 >STM0987 [S] COG2835 Uncharacterized conserved protein Sty Salmonella typhimurium LT2 Length = 60 Score = 71.6 bits (174), Expect = 4e-13, Method: Compositional matrix adjust. Identities = 30/55 (54%), Positives = 44/55 (80%) Query: 1 VNARLLDILVCPLCKGPLDYDKKAQELICKADKLAYPIRDGIPIMWADEARELTA 55 ++ RLL+I+ CP+C G L Y+++ QELICK D LA+P+RDGIP++ +EAR LT+ Sbjct: 1 MDHRLLEIIACPVCNGKLWYNQEQQELICKLDNLAFPLRDGIPVLLENEARALTS 55 >BMEII0403 [S] COG2835 Uncharacterized conserved protein Bme Brucella melitensis Length = 64 Score = 71.6 bits (174), Expect = 4e-13, Method: Compositional matrix adjust. Identities = 31/54 (57%), Positives = 41/54 (75%) Query: 1 VNARLLDILVCPLCKGPLDYDKKAQELICKADKLAYPIRDGIPIMWADEARELT 54 ++ RLL++LVCPL KGPL+YD + EL+ + +LAYP+R GIPIM EAR LT Sbjct: 10 IDVRLLELLVCPLTKGPLEYDAERSELVSRKARLAYPVRGGIPIMLPSEARSLT 63 >ycaR [S] COG2835 Uncharacterized conserved protein Eco Escherichia coli K12 Length = 60 Score = 70.9 bits (172), Expect = 7e-13, Method: Compositional matrix adjust. Identities = 31/55 (56%), Positives = 43/55 (78%) Query: 1 VNARLLDILVCPLCKGPLDYDKKAQELICKADKLAYPIRDGIPIMWADEARELTA 55 ++ RLL+I+ CP+C G L Y+++ QELICK D LA+P+RDGIP++ EAR LTA Sbjct: 1 MDHRLLEIIACPVCNGKLWYNQEKQELICKLDNLAFPLRDGIPVLLETEARVLTA 55 >ZycaR [S] COG2835 Uncharacterized conserved protein EcZ Escherichia coli O157:H7 EDL933 Length = 60 Score = 70.9 bits (172), Expect = 7e-13, Method: Compositional matrix adjust. Identities = 31/55 (56%), Positives = 43/55 (78%) Query: 1 VNARLLDILVCPLCKGPLDYDKKAQELICKADKLAYPIRDGIPIMWADEARELTA 55 ++ RLL+I+ CP+C G L Y+++ QELICK D LA+P+RDGIP++ EAR LTA Sbjct: 1 MDHRLLEIIACPVCNGKLWYNQEKQELICKLDNLAFPLRDGIPVLLETEARVLTA 55 >ECs1000 [S] COG2835 Uncharacterized conserved protein Ecs Escherichia coli O157:H7 Length = 60 Score = 70.9 bits (172), Expect = 7e-13, Method: Compositional matrix adjust. Identities = 31/55 (56%), Positives = 43/55 (78%) Query: 1 VNARLLDILVCPLCKGPLDYDKKAQELICKADKLAYPIRDGIPIMWADEARELTA 55 ++ RLL+I+ CP+C G L Y+++ QELICK D LA+P+RDGIP++ EAR LTA Sbjct: 1 MDHRLLEIIACPVCNGKLWYNQEKQELICKLDNLAFPLRDGIPVLLETEARVLTA 55 >YPO1399 [S] COG2835 Uncharacterized conserved protein Ype Yersinia pestis Length = 60 Score = 68.2 bits (165), Expect = 4e-12, Method: Compositional matrix adjust. Identities = 28/54 (51%), Positives = 42/54 (77%) Query: 1 VNARLLDILVCPLCKGPLDYDKKAQELICKADKLAYPIRDGIPIMWADEARELT 54 ++ RLL+I+ CP+C G L ++K+ EL+CK D LAYP+RDGIP++ +EAR L+ Sbjct: 1 MDHRLLEIVACPVCNGKLYFNKENLELVCKVDNLAYPVRDGIPVLLENEARPLS 54 >msl4429 [S] COG2835 Uncharacterized conserved protein Mlo Mesorhizobium loti Length = 81 Score = 67.4 bits (163), Expect = 7e-12, Method: Compositional matrix adjust. Identities = 32/55 (58%), Positives = 41/55 (74%) Query: 1 VNARLLDILVCPLCKGPLDYDKKAQELICKADKLAYPIRDGIPIMWADEARELTA 55 V+ +LL++L CPL KGPL +D + ELI + KLAYP+RDGIPIM EAR L+A Sbjct: 13 VDPKLLELLACPLTKGPLAWDPERGELISRVAKLAYPVRDGIPIMLPSEARTLSA 67