BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0036.0049.p (122 letters) Database: BlastDatabases/689/689 4735 sequences; 1,619,870 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|300313044|ref|YP_003777136.1| two component response regulato... 243 2e-66 gi|300312802|ref|YP_003776894.1| two component response regulato... 87 3e-19 gi|300310245|ref|YP_003774337.1| receiver domain-containing prot... 79 9e-17 gi|300312287|ref|YP_003776379.1| chemotaxis cheY protein [Herbas... 64 3e-12 gi|300311948|ref|YP_003776040.1| sensor histidine kinase/respons... 62 2e-11 >gi|300313044|ref|YP_003777136.1| two component response regulator protein [Herbaspirillum seropedicae SmR1] Length = 122 Score = 243 bits (621), Expect = 2e-66, Method: Compositional matrix adjust. Identities = 121/122 (99%), Positives = 121/122 (99%) Query: 1 MSGSKQKTVLVVEDHPDSRDLLCEILAHKGLSVMAASDGVEAIALMQSQAPSLVLTDLRM 60 MS SKQKTVLVVEDHPDSRDLLCEILAHKGLSVMAASDGVEAIALMQSQAPSLVLTDLRM Sbjct: 1 MSRSKQKTVLVVEDHPDSRDLLCEILAHKGLSVMAASDGVEAIALMQSQAPSLVLTDLRM 60 Query: 61 PRMDGMELARYIKSDERFGHIPVALISANLPAANARVPEISAFLLKPCSVDHLLTTVTQL 120 PRMDGMELARYIKSDERFGHIPVALISANLPAANARVPEISAFLLKPCSVDHLLTTVTQL Sbjct: 61 PRMDGMELARYIKSDERFGHIPVALISANLPAANARVPEISAFLLKPCSVDHLLTTVTQL 120 Query: 121 LR 122 LR Sbjct: 121 LR 122 >gi|300312802|ref|YP_003776894.1| two component response regulator protein [Herbaspirillum seropedicae SmR1] Length = 125 Score = 87.4 bits (215), Expect = 3e-19, Method: Compositional matrix adjust. Identities = 51/123 (41%), Positives = 76/123 (61%), Gaps = 5/123 (4%) Query: 3 GSKQKTVLVVEDHPDSRDLLCEILAHKGLSVMAASDGVEAIALMQSQAPSL--VLTDLRM 60 S TVLVVED+ + R L E+L G V+ A++G A++++ + + +LTDLRM Sbjct: 4 ASGTSTVLVVEDNSEVRALYSEVLRSDGYRVLEAANGTLALSVLFDRPGDVDVILTDLRM 63 Query: 61 PRMDGMELARYIKSDERFGHIPVALISANLPAANAR--VPEISAFLLKPCSVDHLLTTVT 118 P MDG+ELA +K+DERF IP+ L+SA P N+ +A L KPC ++ LL+T+ Sbjct: 64 PLMDGLELAETLKADERFSAIPLVLLSAT-PMTNSWHARKNFAALLTKPCPLNLLLSTIE 122 Query: 119 QLL 121 +L Sbjct: 123 AVL 125 >gi|300310245|ref|YP_003774337.1| receiver domain-containing protein [Herbaspirillum seropedicae SmR1] Length = 125 Score = 79.3 bits (194), Expect = 9e-17, Method: Compositional matrix adjust. Identities = 45/117 (38%), Positives = 66/117 (56%), Gaps = 5/117 (4%) Query: 5 KQKTVLVVEDHPDSRDLLCEILAHKGLSVMAASDGVEAIALMQSQAP--SLVLTDLRMPR 62 + + +L++ED+ R++ E+ G V A +G E + ++ S S+VLTDLRMP Sbjct: 6 RTRAILIIEDNLYVREIFAEVFDAAGYEVHQAGNGAEGLEILLSSPGRVSVVLTDLRMPV 65 Query: 63 MDGMELARYIKSDERFGHIPVALISANLPAANARVPE--ISAFLLKPCSVDHLLTTV 117 MDG+ A +K D RF +PV L+SA P AN+ +A L+KPC LL TV Sbjct: 66 MDGLRFATELKKDVRFAGLPVVLLSAT-PMANSWEARKVFAALLVKPCPFSQLLDTV 121 >gi|300312287|ref|YP_003776379.1| chemotaxis cheY protein [Herbaspirillum seropedicae SmR1] Length = 121 Score = 64.3 bits (155), Expect = 3e-12, Method: Compositional matrix adjust. Identities = 36/118 (30%), Positives = 60/118 (50%), Gaps = 3/118 (2%) Query: 7 KTVLVVEDHPDSRDLLCEILAHKGLSVMAASDGVEAIALMQSQAPSLVLTDLRMPRMDGM 66 KT+L V+D R ++ L G +V A DGV+A+ +SQ LVLTD MPRMDG+ Sbjct: 3 KTILAVDDSGSLRQMVVFSLKAAGYNVTEAVDGVDALEKAKSQTFDLVLTDQNMPRMDGL 62 Query: 67 ELARYIKSDERFGHIPVALISANLP---AANARVPEISAFLLKPCSVDHLLTTVTQLL 121 L R ++ + +P+ +++ A + + +L+KP L V +++ Sbjct: 63 TLIRSLRELTSYARVPILMLTTEFSDEMKAKGKAAGANGWLVKPFDPQRLTEVVRKVI 120 >gi|300311948|ref|YP_003776040.1| sensor histidine kinase/response regulator protein [Herbaspirillum seropedicae SmR1] Length = 1145 Score = 61.6 bits (148), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 44/128 (34%), Positives = 67/128 (52%), Gaps = 8/128 (6%) Query: 1 MSG--SKQKTVLVVEDHPDSRDLLCEILAHKGLSVMAASDGVEAIALMQSQAPSLVLTDL 58 MSG + +LVV+D R LL ++L G +V A G+ + + P LVL D+ Sbjct: 925 MSGYAGPSRHILVVDDQASQRRLLKDMLMPLGFTVSEADSGLACMETLGHALPDLVLLDI 984 Query: 59 RMPRMDGMELARYIKSDERFGHIPVALISA----NLPAANARVPEISAFLLKPCSVDHLL 114 MP+MDG +AR I++ +P+ L+SA NL N P ++ F++KP S LL Sbjct: 985 AMPQMDGWSVARAIRA-RGLAQLPILLVSANAFENLHERN-EPPLVNDFVVKPVSYHELL 1042 Query: 115 TTVTQLLR 122 + Q L+ Sbjct: 1043 GKIRQHLQ 1050 Database: BlastDatabases/689/689 Posted date: Apr 10, 2011 12:15 AM Number of letters in database: 1,619,870 Number of sequences in database: 4735 Lambda K H 0.320 0.133 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 4735 Number of Hits to DB: 351,857 Number of extensions: 12407 Number of successful extensions: 139 Number of sequences better than 1.0e-08: 19 Number of HSP's gapped: 151 Number of HSP's successfully gapped: 19 Length of query: 122 Length of database: 1,619,870 Length adjustment: 74 Effective length of query: 48 Effective length of database: 1,269,480 Effective search space: 60935040 Effective search space used: 60935040 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 125 (52.8 bits)