BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0037.0069.p (95 letters) Database: BlastDatabases/689/689 4735 sequences; 1,619,870 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|300310592|ref|YP_003774684.1| phosphate regulon two-component... 194 1e-51 gi|300310718|ref|YP_003774810.1| phosphate regulon two-component... 105 7e-25 gi|300310849|ref|YP_003774941.1| two component transcription reg... 65 1e-12 gi|300313665|ref|YP_003777757.1| two component transcription reg... 64 2e-12 gi|300313680|ref|YP_003777772.1| two component response regulato... 61 2e-11 >gi|300310592|ref|YP_003774684.1| phosphate regulon two-component response regulator transcription regulator protein [Herbaspirillum seropedicae SmR1] Length = 245 Score = 194 bits (493), Expect = 1e-51, Method: Compositional matrix adjust. Identities = 94/95 (98%), Positives = 95/95 (100%) Query: 1 MSAGPVTLDPASCSVSLSGARIDIGHAEYKLLKFFLAHPDRVFSRSQLLDRVWGDHVVIE 60 MSAGP+TLDPASCSVSLSGARIDIGHAEYKLLKFFLAHPDRVFSRSQLLDRVWGDHVVIE Sbjct: 151 MSAGPITLDPASCSVSLSGARIDIGHAEYKLLKFFLAHPDRVFSRSQLLDRVWGDHVVIE 210 Query: 61 ERTVDVHVLRLRKALRDAEYLIKTVRSVGYMLSTK 95 ERTVDVHVLRLRKALRDAEYLIKTVRSVGYMLSTK Sbjct: 211 ERTVDVHVLRLRKALRDAEYLIKTVRSVGYMLSTK 245 >gi|300310718|ref|YP_003774810.1| phosphate regulon two-component response regulator transcription regulator protein [Herbaspirillum seropedicae SmR1] Length = 230 Score = 105 bits (262), Expect = 7e-25, Method: Compositional matrix adjust. Identities = 46/90 (51%), Positives = 69/90 (76%) Query: 6 VTLDPASCSVSLSGARIDIGHAEYKLLKFFLAHPDRVFSRSQLLDRVWGDHVVIEERTVD 65 +++D VS++ + + AE+KLL++ +AHP+R+FSR+QLLD+VWGDH IEERTVD Sbjct: 140 ISIDVERRQVSVADKPVLLDQAEFKLLRYLVAHPERIFSRAQLLDKVWGDHTFIEERTVD 199 Query: 66 VHVLRLRKALRDAEYLIKTVRSVGYMLSTK 95 VH++RLRK+L D + ++TVR +GY LS + Sbjct: 200 VHIMRLRKSLGDLAHYVQTVRGMGYKLSAE 229 >gi|300310849|ref|YP_003774941.1| two component transcription regulator protein [Herbaspirillum seropedicae SmR1] Length = 248 Score = 65.1 bits (157), Expect = 1e-12, Method: Compositional matrix adjust. Identities = 35/83 (42%), Positives = 52/83 (62%), Gaps = 3/83 (3%) Query: 15 VSLSGARIDIGHAEYKLLKFFLAHPDRVFSRSQLLDRVWGDHVVIEERTVDVHVLRLRKA 74 V+ G + + AE++LLK FL HP+RV +R QLL+ G +R+VD+ + RLR+ Sbjct: 155 VNRDGVVVALSGAEFRLLKVFLDHPNRVLNRDQLLELTQGRESDPFDRSVDIQISRLRQK 214 Query: 75 LRD---AEYLIKTVRSVGYMLST 94 L D +IKTVR+ GY+L+T Sbjct: 215 LGDDARTPTIIKTVRNEGYVLAT 237 >gi|300313665|ref|YP_003777757.1| two component transcription regulator protein [Herbaspirillum seropedicae SmR1] Length = 240 Score = 64.3 bits (155), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 35/85 (41%), Positives = 53/85 (62%), Gaps = 3/85 (3%) Query: 11 ASCSVSLSGARIDIGHAEYKLLKFFLAHPDRVFSRSQLLDRVWGDHVVIEERTVDVHVLR 70 A ++S SG I +G ++Y++L+ L HP R SR LL+ V+G + +R++DV + R Sbjct: 148 ARQAISPSGVTITLGGSDYQVLRALLEHPRRALSRDFLLNTVYGKEAMPFDRSIDVCISR 207 Query: 71 LRKALRD---AEYLIKTVRSVGYML 92 LR+ L D LI+TVR+ GYML Sbjct: 208 LRQQLGDNPREPALIRTVRNTGYML 232 >gi|300313680|ref|YP_003777772.1| two component response regulator protein [Herbaspirillum seropedicae SmR1] Length = 218 Score = 61.2 bits (147), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 33/87 (37%), Positives = 53/87 (60%), Gaps = 2/87 (2%) Query: 6 VTLDPASCSVSLSGARIDIGHAEYKLLKFFLAHPDRVFSRSQLLDRVWGDHVVIEERTVD 65 V L+PA+ V++SG +++ E+ LL+ F+ P V SR+QL ++++G IE V+ Sbjct: 132 VILNPATHEVTVSGKPVNLSAREFTLLQAFMDRPGVVLSRAQLEEKLYGWDDSIESNAVE 191 Query: 66 VHVLRLRKALRDAEYLIKTVRSVGYML 92 VH+ LRK + IK VR VGY++ Sbjct: 192 VHIHALRKKV--GSDFIKNVRGVGYLV 216 Database: BlastDatabases/689/689 Posted date: Apr 10, 2011 12:15 AM Number of letters in database: 1,619,870 Number of sequences in database: 4735 Lambda K H 0.324 0.138 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 4735 Number of Hits to DB: 277,094 Number of extensions: 9208 Number of successful extensions: 60 Number of sequences better than 1.0e-08: 7 Number of HSP's gapped: 63 Number of HSP's successfully gapped: 7 Length of query: 95 Length of database: 1,619,870 Length adjustment: 64 Effective length of query: 31 Effective length of database: 1,316,830 Effective search space: 40821730 Effective search space used: 40821730 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 123 (52.0 bits)