BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0035.0001.p (133 letters) Database: BlastDatabases/689/689 4735 sequences; 1,619,870 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|300309402|ref|YP_003773494.1| nitrate/sulfonate/bicarbonate A... 251 1e-68 gi|300311841|ref|YP_003775933.1| nitrate/sulfonate/bicarbonate A... 144 2e-36 gi|300309717|ref|YP_003773809.1| nitrate/sulfonate/bicarbonate A... 101 2e-23 gi|300311645|ref|YP_003775737.1| taurine ABC transporter ATPase ... 98 3e-22 gi|300310542|ref|YP_003774634.1| nitrate transporter ATPase [Her... 87 3e-19 >gi|300309402|ref|YP_003773494.1| nitrate/sulfonate/bicarbonate ABC transporter ATPase [Herbaspirillum seropedicae SmR1] Length = 290 Score = 251 bits (641), Expect = 1e-68, Method: Compositional matrix adjust. Identities = 127/133 (95%), Positives = 129/133 (96%) Query: 1 MKARVAIARALAMQPKMLLMDEPFAALDALTRRKMQEELLALWDEVRFTLLFVTHSIEEA 60 MKARVAIARALAMQPKMLLMDEPFAALDALTRRKMQEELLALWDEVRFTLLFVTHSIEEA Sbjct: 158 MKARVAIARALAMQPKMLLMDEPFAALDALTRRKMQEELLALWDEVRFTLLFVTHSIEEA 217 Query: 61 LVVGNRILLLSPHPGRVRAEINSHQYDLSSLGGVGFQQTAQRIHRLLFDEGGETSAASTA 120 LVVGNRILLLSPHPGRVRAEINSHQYDLSSLGGVGFQQTAQRIHRLLFDEGG + AAS A Sbjct: 218 LVVGNRILLLSPHPGRVRAEINSHQYDLSSLGGVGFQQTAQRIHRLLFDEGGPSDAASAA 277 Query: 121 APVINFSDVRFSY 133 AP +NFSDVRFSY Sbjct: 278 APTLNFSDVRFSY 290 >gi|300311841|ref|YP_003775933.1| nitrate/sulfonate/bicarbonate ABC transporter ATPase [Herbaspirillum seropedicae SmR1] Length = 263 Score = 144 bits (364), Expect = 2e-36, Method: Compositional matrix adjust. Identities = 72/108 (66%), Positives = 87/108 (80%), Gaps = 2/108 (1%) Query: 1 MKARVAIARALAMQPKMLLMDEPFAALDALTRRKMQEELLALWDEVRFTLLFVTHSIEEA 60 MK RV+IAR +AM+P +LLMDEPFAALDALTRRKMQ+ELL LWD+ +FT+LFVTHSIEEA Sbjct: 155 MKQRVSIARGMAMEPDVLLMDEPFAALDALTRRKMQDELLRLWDDTQFTVLFVTHSIEEA 214 Query: 61 LVVGNRILLLSPHPGRVRAEINSHQYDLSSLGGVGFQQTAQRIHRLLF 108 + VG RILLL+PHPG+VRAE+NS D S LG + RI+ +LF Sbjct: 215 IRVGTRILLLTPHPGQVRAELNS--IDPSQLGTAAQAELETRINDMLF 260 >gi|300309717|ref|YP_003773809.1| nitrate/sulfonate/bicarbonate ABC transporter ATPase [Herbaspirillum seropedicae SmR1] Length = 269 Score = 101 bits (252), Expect = 2e-23, Method: Compositional matrix adjust. Identities = 46/81 (56%), Positives = 65/81 (80%) Query: 1 MKARVAIARALAMQPKMLLMDEPFAALDALTRRKMQEELLALWDEVRFTLLFVTHSIEEA 60 M+ RVAIAR LA+ ++LMDEPF ALDALTRR +Q+ELL +WDE R T++FVTHSIEEA Sbjct: 145 MRQRVAIARVLALDSPIMLMDEPFGALDALTRRNLQDELLRIWDEFRKTIVFVTHSIEEA 204 Query: 61 LVVGNRILLLSPHPGRVRAEI 81 + + +RI++++ PG V+ ++ Sbjct: 205 IYLADRIVVMTYRPGTVKRDM 225 >gi|300311645|ref|YP_003775737.1| taurine ABC transporter ATPase [Herbaspirillum seropedicae SmR1] Length = 261 Score = 97.8 bits (242), Expect = 3e-22, Method: Compositional matrix adjust. Identities = 43/83 (51%), Positives = 61/83 (73%) Query: 1 MKARVAIARALAMQPKMLLMDEPFAALDALTRRKMQEELLALWDEVRFTLLFVTHSIEEA 60 M+ RV +ARALA PK+LLMDEPF ALD++TR +MQE L+++W + F+THSIEEA Sbjct: 138 MRQRVGLARALAPNPKILLMDEPFGALDSMTREQMQELLVSVWARTGKQVFFITHSIEEA 197 Query: 61 LVVGNRILLLSPHPGRVRAEINS 83 L +G ++++SP PGR+ A + Sbjct: 198 LFLGTEVIVMSPRPGRIVARFET 220 >gi|300310542|ref|YP_003774634.1| nitrate transporter ATPase [Herbaspirillum seropedicae SmR1] Length = 272 Score = 87.4 bits (215), Expect = 3e-19, Method: Compositional matrix adjust. Identities = 41/81 (50%), Positives = 60/81 (74%) Query: 1 MKARVAIARALAMQPKMLLMDEPFAALDALTRRKMQEELLALWDEVRFTLLFVTHSIEEA 60 MK RV IARALAM+PK+LLMDEPF ALDALTR +Q+ELL + + T++ VTH ++EA Sbjct: 149 MKQRVGIARALAMEPKVLLMDEPFGALDALTRAHLQDELLKIVAKTDSTVVMVTHDVDEA 208 Query: 61 LVVGNRILLLSPHPGRVRAEI 81 +++ +RI++++ P E+ Sbjct: 209 VLLSDRIVMMTNGPAATIGEV 229 Database: BlastDatabases/689/689 Posted date: Apr 10, 2011 12:15 AM Number of letters in database: 1,619,870 Number of sequences in database: 4735 Lambda K H 0.323 0.135 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 4735 Number of Hits to DB: 389,875 Number of extensions: 14347 Number of successful extensions: 204 Number of sequences better than 1.0e-08: 30 Number of HSP's gapped: 216 Number of HSP's successfully gapped: 30 Length of query: 133 Length of database: 1,619,870 Length adjustment: 75 Effective length of query: 58 Effective length of database: 1,264,745 Effective search space: 73355210 Effective search space used: 73355210 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 125 (52.8 bits)