BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0032.0150.p (117 letters) Database: BlastDatabases/689/689 4735 sequences; 1,619,870 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|300310884|ref|YP_003774976.1| chemotaxis regulator protein [H... 231 1e-62 gi|300311293|ref|YP_003775385.1| chemotaxis regulator protein [H... 215 6e-58 gi|300311026|ref|YP_003775118.1| chemotaxis response regulator r... 176 5e-46 gi|300311339|ref|YP_003775431.1| CheY chemotaxis protein [Herbas... 144 2e-36 gi|300312287|ref|YP_003776379.1| chemotaxis cheY protein [Herbas... 76 6e-16 >gi|300310884|ref|YP_003774976.1| chemotaxis regulator protein [Herbaspirillum seropedicae SmR1] Length = 133 Score = 231 bits (588), Expect = 1e-62, Method: Compositional matrix adjust. Identities = 112/117 (95%), Positives = 116/117 (99%) Query: 1 MRRIVSGLLKELEYTKIVEADDGSTALKILESGASNITFVLTDWNMPVMDGLTLLKKIRS 60 MRRIVSGLLKELEYTKIVEADDGS+ALKILESGASNITFVLTDWNMPVMDGLTLLKKIRS Sbjct: 17 MRRIVSGLLKELEYTKIVEADDGSSALKILESGASNITFVLTDWNMPVMDGLTLLKKIRS 76 Query: 61 TPSLAHLPVLMITAEAKKENIVTAAQEGADGYIVKPFNATTLKEKIEKILARRAHMK 117 TP+L+HLPVLMITAEAKKENIV AAQEGADGYIVKPFNATTLKEKIEKILARRAHM+ Sbjct: 77 TPALSHLPVLMITAEAKKENIVMAAQEGADGYIVKPFNATTLKEKIEKILARRAHMQ 133 >gi|300311293|ref|YP_003775385.1| chemotaxis regulator protein [Herbaspirillum seropedicae SmR1] Length = 135 Score = 215 bits (548), Expect = 6e-58, Method: Compositional matrix adjust. Identities = 104/116 (89%), Positives = 111/116 (95%) Query: 1 MRRIVSGLLKELEYTKIVEADDGSTALKILESGASNITFVLTDWNMPVMDGLTLLKKIRS 60 MRRIVSGLLKELEYTKIVEADDGS+ALKILE+GA +TFVLTDWNMPVMDGLTLLKKIR+ Sbjct: 17 MRRIVSGLLKELEYTKIVEADDGSSALKILEAGALPVTFVLTDWNMPVMDGLTLLKKIRA 76 Query: 61 TPSLAHLPVLMITAEAKKENIVTAAQEGADGYIVKPFNATTLKEKIEKILARRAHM 116 TPS+AHLPVLMITAEAKKENIV AAQ GADGYIVKPFNA TLK+KIEKILARRAH+ Sbjct: 77 TPSMAHLPVLMITAEAKKENIVEAAQSGADGYIVKPFNAATLKDKIEKILARRAHL 132 >gi|300311026|ref|YP_003775118.1| chemotaxis response regulator receiver domain-containing protein [Herbaspirillum seropedicae SmR1] Length = 134 Score = 176 bits (446), Expect = 5e-46, Method: Compositional matrix adjust. Identities = 85/116 (73%), Positives = 97/116 (83%) Query: 1 MRRIVSGLLKELEYTKIVEADDGSTALKILESGASNITFVLTDWNMPVMDGLTLLKKIRS 60 MRRI+ GLLKELEY K+ +ADDG++A KILESGA I+FV+TDWNMP MDGL LLKKIR Sbjct: 16 MRRIIIGLLKELEYLKVTDADDGTSAWKILESGALPISFVITDWNMPGMDGLGLLKKIRE 75 Query: 61 TPSLAHLPVLMITAEAKKENIVTAAQEGADGYIVKPFNATTLKEKIEKILARRAHM 116 TP L LPVLM++AEAKKENIV AA+ GADGYIVKPFNA TL +KI KIL RR+ M Sbjct: 76 TPRLKRLPVLMVSAEAKKENIVLAAETGADGYIVKPFNAATLDDKISKILQRRSSM 131 >gi|300311339|ref|YP_003775431.1| CheY chemotaxis protein [Herbaspirillum seropedicae SmR1] Length = 131 Score = 144 bits (362), Expect = 2e-36, Method: Compositional matrix adjust. Identities = 71/114 (62%), Positives = 86/114 (75%), Gaps = 2/114 (1%) Query: 1 MRRIVSGLLKELEYTKIVEADDGSTALKILESGASNITFVLTDWNMPVMDGLTLLKKIRS 60 MRRIV LLKEL YT + EA+DG AL+ L S FV++DWNMP MDGLT+L++IR Sbjct: 17 MRRIVRNLLKELGYTNVDEAEDGVQALQKLRS--DQFDFVVSDWNMPNMDGLTMLQEIRK 74 Query: 61 TPSLAHLPVLMITAEAKKENIVTAAQEGADGYIVKPFNATTLKEKIEKILARRA 114 P+L+ LPVLM+TAEAKKENIV AAQ GA+GY+VKPF A TL EK+ KI + A Sbjct: 75 DPALSKLPVLMVTAEAKKENIVAAAQAGANGYVVKPFTAATLDEKLGKIFEKMA 128 >gi|300312287|ref|YP_003776379.1| chemotaxis cheY protein [Herbaspirillum seropedicae SmR1] Length = 121 Score = 76.3 bits (186), Expect = 6e-16, Method: Compositional matrix adjust. Identities = 43/111 (38%), Positives = 64/111 (57%), Gaps = 3/111 (2%) Query: 1 MRRIVSGLLKELEYTKIVEADDGSTALKILESGASNITFVLTDWNMPVMDGLTLLKKIRS 60 +R++V LK Y + EA DG AL+ ++ + VLTD NMP MDGLTL++ +R Sbjct: 14 LRQMVVFSLKAAGYN-VTEAVDGVDALE--KAKSQTFDLVLTDQNMPRMDGLTLIRSLRE 70 Query: 61 TPSLAHLPVLMITAEAKKENIVTAAQEGADGYIVKPFNATTLKEKIEKILA 111 S A +P+LM+T E E GA+G++VKPF+ L E + K++ Sbjct: 71 LTSYARVPILMLTTEFSDEMKAKGKAAGANGWLVKPFDPQRLTEVVRKVIG 121 Database: BlastDatabases/689/689 Posted date: Apr 10, 2011 12:15 AM Number of letters in database: 1,619,870 Number of sequences in database: 4735 Lambda K H 0.316 0.131 0.356 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 4735 Number of Hits to DB: 321,904 Number of extensions: 10659 Number of successful extensions: 129 Number of sequences better than 1.0e-08: 17 Number of HSP's gapped: 147 Number of HSP's successfully gapped: 17 Length of query: 117 Length of database: 1,619,870 Length adjustment: 74 Effective length of query: 43 Effective length of database: 1,269,480 Effective search space: 54587640 Effective search space used: 54587640 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 124 (52.4 bits)