BLASTP 2.2.18 [Mar-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 0029.0039.p
         (42 letters)

Database: BlastDatabases/689/689 
           4735 sequences; 1,619,870 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|300311949|ref|YP_003776041.1| two component response regulato...    62   6e-12

>gi|300311949|ref|YP_003776041.1| two component response regulator
           protein [Herbaspirillum seropedicae SmR1]
          Length = 318

 Score = 62.4 bits (150), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 30/33 (90%), Positives = 31/33 (93%)

Query: 1   MSPRTVNKHLEHIFVKLGVETRSAAAVLASSLT 33
           MSPRTVNKHLEHIFVKLGVETRSAAAVLA + T
Sbjct: 285 MSPRTVNKHLEHIFVKLGVETRSAAAVLARAST 317


  Database: BlastDatabases/689/689
    Posted date:  Apr 10, 2011 12:15 AM
  Number of letters in database: 1,619,870
  Number of sequences in database:  4735
  
Lambda     K      H
   0.313    0.119    0.299 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 4735
Number of Hits to DB: 59,092
Number of extensions: 613
Number of successful extensions: 6
Number of sequences better than 1.0e-08: 1
Number of HSP's gapped: 6
Number of HSP's successfully gapped: 1
Length of query: 42
Length of database: 1,619,870
Length adjustment: 16
Effective length of query: 26
Effective length of database: 1,544,110
Effective search space: 40146860
Effective search space used: 40146860
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 123 (52.0 bits)