BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0028.0004.p (141 letters) Database: BlastDatabases/689/689 4735 sequences; 1,619,870 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|300310455|ref|YP_003774547.1| AsnC family transcription regul... 134 4e-33 gi|300311014|ref|YP_003775106.1| leucine-responsive regulatory D... 84 4e-18 gi|300309515|ref|YP_003773607.1| leucine-responsive regulatory p... 79 1e-16 gi|300313266|ref|YP_003777358.1| AsnC family transcription regul... 74 3e-15 gi|300312130|ref|YP_003776222.1| glutamate uptake transcription ... 72 1e-14 >gi|300310455|ref|YP_003774547.1| AsnC family transcription regulator protein [Herbaspirillum seropedicae SmR1] Length = 164 Score = 134 bits (336), Expect = 4e-33, Method: Compositional matrix adjust. Identities = 65/131 (49%), Positives = 89/131 (67%) Query: 1 VELAEAVNLSPSPCLTRTKRMEETGVIAGYAARVALDKLGSHVVVFSEITLGSHRPADFR 60 V LA+AV LSPSPCL R KR+E+ G I+GY A + L+KL +VF+E+TL HR DF Sbjct: 29 VILADAVGLSPSPCLIRVKRLEKAGYISGYGAYIRLEKLADVQIVFTEVTLSDHRREDFA 88 Query: 61 KFEQGAAKYAEIVECYNVSGGYDYLLKIVSPTVALFQELMERLLEDEIGIEKFASRIVLR 120 KFE EI+EC+ VSGGYDYLLK ++ +V +Q ++E LLE + IEK+ S IV++ Sbjct: 89 KFESTIRNVDEIIECHLVSGGYDYLLKFMTRSVVHYQSVIESLLEQNLRIEKYFSYIVIK 148 Query: 121 HPYEQRVEPVE 131 P+ + P+E Sbjct: 149 SPFVKHHYPLE 159 >gi|300311014|ref|YP_003775106.1| leucine-responsive regulatory DNA-binding transcription regulator protein [Herbaspirillum seropedicae SmR1] Length = 162 Score = 84.0 bits (206), Expect = 4e-18, Method: Compositional matrix adjust. Identities = 48/130 (36%), Positives = 73/130 (56%) Query: 2 ELAEAVNLSPSPCLTRTKRMEETGVIAGYAARVALDKLGSHVVVFSEITLGSHRPADFRK 61 EL E V LS +PC+ R +RME GVI GY ARV + LG+ ++VF EITL F + Sbjct: 32 ELGEQVGLSVTPCIERVRRMERDGVITGYYARVNPESLGATLLVFVEITLNHKSGNMFEQ 91 Query: 62 FEQGAAKYAEIVECYNVSGGYDYLLKIVSPTVALFQELMERLLEDEIGIEKFASRIVLRH 121 F + + E+ EC+ VSG +DYL+K +A +++L+ +L G + S +V+ Sbjct: 92 FRREVLRIPEVQECHLVSGDFDYLIKARIRGMAEYRKLLGDILLQLPGAAQSKSYVVMEE 151 Query: 122 PYEQRVEPVE 131 E P++ Sbjct: 152 IKETLALPLD 161 >gi|300309515|ref|YP_003773607.1| leucine-responsive regulatory protein [Herbaspirillum seropedicae SmR1] Length = 154 Score = 79.3 bits (194), Expect = 1e-16, Method: Compositional matrix adjust. Identities = 37/87 (42%), Positives = 57/87 (65%) Query: 1 VELAEAVNLSPSPCLTRTKRMEETGVIAGYAARVALDKLGSHVVVFSEITLGSHRPADFR 60 V+LA VNLSP+ CL R ++++E G I GYAA++ + L ++VF E+ L P F Sbjct: 24 VDLAARVNLSPAACLERVRKLQEAGYILGYAAQLNPELLDVSLLVFIEVVLDRTTPDVFA 83 Query: 61 KFEQGAAKYAEIVECYNVSGGYDYLLK 87 +F++ EI+EC+ V+GG+DYL+K Sbjct: 84 EFKKSVQSIPEIMECHMVAGGFDYLVK 110 >gi|300313266|ref|YP_003777358.1| AsnC family transcription regulator protein [Herbaspirillum seropedicae SmR1] Length = 159 Score = 74.3 bits (181), Expect = 3e-15, Method: Compositional matrix adjust. Identities = 42/121 (34%), Positives = 62/121 (51%) Query: 1 VELAEAVNLSPSPCLTRTKRMEETGVIAGYAARVALDKLGSHVVVFSEITLGSHRPADFR 60 +ELA +NLSPSP L R KR+E G+I+ Y A LG V VF ++ L Sbjct: 23 LELASRINLSPSPTLARVKRLESEGIISRYVALADPHLLGLKVNVFVKVILERQGAEALA 82 Query: 61 KFEQGAAKYAEIVECYNVSGGYDYLLKIVSPTVALFQELMERLLEDEIGIEKFASRIVLR 120 +FE + + E++E Y ++G DYLL+IV P + + + L GI+ S L+ Sbjct: 83 QFETAVSAFDEVMEVYLMTGDEDYLLRIVVPDLLTLEHFIVDHLTKIPGIKNIRSSFALK 142 Query: 121 H 121 Sbjct: 143 Q 143 >gi|300312130|ref|YP_003776222.1| glutamate uptake transcription regulator protein [Herbaspirillum seropedicae SmR1] Length = 154 Score = 72.4 bits (176), Expect = 1e-14, Method: Compositional matrix adjust. Identities = 36/103 (34%), Positives = 55/103 (53%) Query: 2 ELAEAVNLSPSPCLTRTKRMEETGVIAGYAARVALDKLGSHVVVFSEITLGSHRPADFRK 61 E+AE VNLS +PC R +R+E GVI + +KL V V EI H + +K Sbjct: 23 EIAECVNLSTTPCWRRIQRLEAEGVIKRRVVLLDAEKLNVSVTVLVEIKTRQHSASWLKK 82 Query: 62 FEQGAAKYAEIVECYNVSGGYDYLLKIVSPTVALFQELMERLL 104 F E+VE + +SG DY+LK++ P + + + +RL+ Sbjct: 83 FRDVVTCIPEVVEVHRMSGHIDYMLKVMVPNIGAYDSVYKRLI 125 Database: BlastDatabases/689/689 Posted date: Apr 10, 2011 12:15 AM Number of letters in database: 1,619,870 Number of sequences in database: 4735 Lambda K H 0.318 0.135 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 4735 Number of Hits to DB: 422,194 Number of extensions: 15922 Number of successful extensions: 43 Number of sequences better than 1.0e-08: 9 Number of HSP's gapped: 43 Number of HSP's successfully gapped: 9 Length of query: 141 Length of database: 1,619,870 Length adjustment: 76 Effective length of query: 65 Effective length of database: 1,260,010 Effective search space: 81900650 Effective search space used: 81900650 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 126 (53.1 bits)