BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0027.0079.p (173 letters) Database: BlastDatabases/689/689 4735 sequences; 1,619,870 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|300313547|ref|YP_003777639.1| nitrate/sulfonate/bicarbonate A... 247 4e-67 gi|300312685|ref|YP_003776777.1| nitrate/sulfonate/bicarbonate A... 84 6e-18 gi|300312969|ref|YP_003777061.1| nitrate/sulfonate/bicarbonate A... 83 1e-17 gi|300312621|ref|YP_003776713.1| ABC transporter ATPase [Herbasp... 79 2e-16 gi|300309802|ref|YP_003773894.1| nitrate/sulfonate/bicarbonate A... 77 7e-16 >gi|300313547|ref|YP_003777639.1| nitrate/sulfonate/bicarbonate ABC transporter ATPase [Herbaspirillum seropedicae SmR1] Length = 261 Score = 247 bits (630), Expect = 4e-67, Method: Compositional matrix adjust. Identities = 118/120 (98%), Positives = 120/120 (100%) Query: 1 MSEPFVDFRHVYLAYDGAAEFAVEDIDLQTRAGEFIAIVGPSGCGKSTFMKLATGLKQPN 60 MSEPFVDFRHVYLAYDGAAEFAVEDIDLQTRAGEFIAIVGPSGCGKSTFMKLATGLKQPN Sbjct: 1 MSEPFVDFRHVYLAYDGAAEFAVEDIDLQTRAGEFIAIVGPSGCGKSTFMKLATGLKQPN 60 Query: 61 RGSVVINGQTVTGPLKFVGMAFQAPTLLPWRTTLENVLLPLEIVEPYRRDFKQKKAEYTE 120 RGSVVI+GQTVTGPLKFVGMAFQAPTLLPWRTTL+NVLLPLEIVEPYRRDFKQKKAEYTE Sbjct: 61 RGSVVIDGQTVTGPLKFVGMAFQAPTLLPWRTTLDNVLLPLEIVEPYRRDFKQKKAEYTE 120 >gi|300312685|ref|YP_003776777.1| nitrate/sulfonate/bicarbonate ABC transporter ATPase [Herbaspirillum seropedicae SmR1] Length = 275 Score = 84.0 bits (206), Expect = 6e-18, Method: Compositional matrix adjust. Identities = 41/97 (42%), Positives = 57/97 (58%), Gaps = 3/97 (3%) Query: 4 PFVDFRHV---YLAYDGAAEFAVEDIDLQTRAGEFIAIVGPSGCGKSTFMKLATGLKQPN 60 P ++ R+V ++ DG A A+ D + GEF+A+VGP+GCGKST + L TGL +P Sbjct: 20 PAIELRNVSCRFITADGRATVALRDFSMSVARGEFVAVVGPTGCGKSTTLSLITGLLKPT 79 Query: 61 RGSVVINGQTVTGPLKFVGMAFQAPTLLPWRTTLENV 97 G V + GQ V G +G FQ + PWR+ ENV Sbjct: 80 LGEVRVMGQPVNGIDPRIGFVFQNDAVFPWRSVRENV 116 >gi|300312969|ref|YP_003777061.1| nitrate/sulfonate/bicarbonate ABC transporter ATPase [Herbaspirillum seropedicae SmR1] Length = 269 Score = 83.2 bits (204), Expect = 1e-17, Method: Compositional matrix adjust. Identities = 42/99 (42%), Positives = 61/99 (61%), Gaps = 4/99 (4%) Query: 22 AVEDIDLQTRAGEFIAIVGPSGCGKSTFMKLATGLKQPNRGSVVINGQTVTGPLKFVGMA 81 AV + DL GEF+++VGP+GCGKST + + GL QP+ GSV + G+ + G + G Sbjct: 26 AVANTDLAIAPGEFVSVVGPTGCGKSTLLNVGAGLLQPSSGSVKVFGEELKGINRRAGYM 85 Query: 82 FQAPTLLPWRTTLENVLLPLEIVEPYRRDFKQKKAEYTE 120 FQA L+PWR+ L+NV+ L+ YR ++ AE E Sbjct: 86 FQAEALMPWRSALQNVIAGLQ----YRGHEEKAAAELGE 120 >gi|300312621|ref|YP_003776713.1| ABC transporter ATPase [Herbaspirillum seropedicae SmR1] Length = 257 Score = 79.0 bits (193), Expect = 2e-16, Method: Compositional matrix adjust. Identities = 37/80 (46%), Positives = 52/80 (65%) Query: 23 VEDIDLQTRAGEFIAIVGPSGCGKSTFMKLATGLKQPNRGSVVINGQTVTGPLKFVGMAF 82 +E+ + +GE +A+VGPSGCGKST + +A GL++P+ GSV +GQT+ GP + F Sbjct: 18 IEEFTREIASGELVALVGPSGCGKSTLLHMAAGLEKPSSGSVAGDGQTIRGPHPERTLMF 77 Query: 83 QAPTLLPWRTTLENVLLPLE 102 Q L PW T +NV L LE Sbjct: 78 QENALYPWLTLQQNVALALE 97 >gi|300309802|ref|YP_003773894.1| nitrate/sulfonate/bicarbonate ABC transporter ATPase [Herbaspirillum seropedicae SmR1] Length = 278 Score = 77.0 bits (188), Expect = 7e-16, Method: Compositional matrix adjust. Identities = 36/85 (42%), Positives = 56/85 (65%), Gaps = 3/85 (3%) Query: 22 AVEDIDLQTRAGEFIAIVGPSGCGKSTFMKLATGLKQPNRGSVVI---NGQTVTGPLKFV 78 A++++ L GEF++++GPSGCGKST +K+ GL++P+ G + N TV P + + Sbjct: 35 ALDEVRLDIGRGEFVSLLGPSGCGKSTLLKMFAGLEEPSHGHIRWWGGNLATVGTPERTL 94 Query: 79 GMAFQAPTLLPWRTTLENVLLPLEI 103 M FQ TL+PW T +NV LPL++ Sbjct: 95 AMVFQEATLMPWATVEQNVRLPLDL 119 Database: BlastDatabases/689/689 Posted date: Apr 10, 2011 12:15 AM Number of letters in database: 1,619,870 Number of sequences in database: 4735 Lambda K H 0.321 0.133 0.437 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 4735 Number of Hits to DB: 479,102 Number of extensions: 17575 Number of successful extensions: 261 Number of sequences better than 1.0e-08: 49 Number of HSP's gapped: 239 Number of HSP's successfully gapped: 49 Length of query: 173 Length of database: 1,619,870 Length adjustment: 79 Effective length of query: 94 Effective length of database: 1,245,805 Effective search space: 117105670 Effective search space used: 117105670 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 127 (53.5 bits)