BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0024.0108.p (87 letters) Database: BlastDatabases/689/689 4735 sequences; 1,619,870 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|300313283|ref|YP_003777375.1| branched-chain amino acid ABC t... 160 3e-41 gi|300312240|ref|YP_003776332.1| amino acid ABC transporter ATPa... 72 1e-14 gi|300313935|ref|YP_003778027.1| branched-chain amino acid ABC t... 71 2e-14 gi|300310524|ref|YP_003774616.1| branched-chain amino acid ABC t... 69 5e-14 gi|300309522|ref|YP_003773614.1| branched-chain amino acid ABC t... 69 5e-14 >gi|300313283|ref|YP_003777375.1| branched-chain amino acid ABC transporter ATPase [Herbaspirillum seropedicae SmR1] Length = 233 Score = 160 bits (404), Expect = 3e-41, Method: Compositional matrix adjust. Identities = 84/87 (96%), Positives = 85/87 (97%) Query: 1 MVSPSILLLDEPMEGLAPIIVQELLKVIRRLVSEEGMSVIVVEQHARMALSLTQRAIVLD 60 MVSPSILLLDEPMEGLAPIIVQELLKVIRRLVSEEGMSVIVVEQHARMALSLTQRAIVLD Sbjct: 147 MVSPSILLLDEPMEGLAPIIVQELLKVIRRLVSEEGMSVIVVEQHARMALSLTQRAIVLD 206 Query: 61 RGRIVHASDSQSLLDDGETLDRLVAVA 87 RGRIVHASDSQSLL DG+ LDRLVAVA Sbjct: 207 RGRIVHASDSQSLLADGDKLDRLVAVA 233 >gi|300312240|ref|YP_003776332.1| amino acid ABC transporter ATPase [Herbaspirillum seropedicae SmR1] Length = 243 Score = 71.6 bits (174), Expect = 1e-14, Method: Compositional matrix adjust. Identities = 33/76 (43%), Positives = 53/76 (69%), Gaps = 1/76 (1%) Query: 1 MVSPSILLLDEPMEGLAPIIVQELLKVIRRLVSEEGMSVIVVEQHARMALSLTQRAIVLD 60 M P +LLLDEP GLAP+I+QE+ ++++ +++ GM+V++VEQ+ R AL + QR VL+ Sbjct: 159 MAKPKVLLLDEPSMGLAPLIIQEIFRIVQE-INKTGMTVLLVEQNVRQALRIAQRGYVLE 217 Query: 61 RGRIVHASDSQSLLDD 76 G+IV +LL + Sbjct: 218 TGKIVLEDSGANLLGN 233 >gi|300313935|ref|YP_003778027.1| branched-chain amino acid ABC transporter ATPase [Herbaspirillum seropedicae SmR1] Length = 234 Score = 71.2 bits (173), Expect = 2e-14, Method: Compositional matrix adjust. Identities = 38/87 (43%), Positives = 59/87 (67%), Gaps = 3/87 (3%) Query: 1 MVSPSILLLDEPMEGLAPIIVQELLKVIRRLVSEEGMSVIVVEQHARMALSLTQRAIVLD 60 M P +L+LDEP+EGLAP+IV E++ IR+ + GMS+I+VEQ+ + L R +++ Sbjct: 146 MTHPRVLMLDEPVEGLAPVIVDEIVAQIRQ-IKATGMSIILVEQNLEVCTQLADRHYIVE 204 Query: 61 RGRIV-HASDSQSLLDDGETLDRLVAV 86 +GRIV H S+++ L D+G DR + V Sbjct: 205 QGRIVYHGSNAEFLADEG-VKDRYLGV 230 >gi|300310524|ref|YP_003774616.1| branched-chain amino acid ABC transporter ATPase [Herbaspirillum seropedicae SmR1] Length = 241 Score = 69.3 bits (168), Expect = 5e-14, Method: Compositional matrix adjust. Identities = 33/76 (43%), Positives = 53/76 (69%), Gaps = 1/76 (1%) Query: 1 MVSPSILLLDEPMEGLAPIIVQELLKVIRRLVSEEGMSVIVVEQHARMALSLTQRAIVLD 60 M P +LLLDEP GL+PI+V+++ +VIR VS +G+++++VEQ+A++AL R V++ Sbjct: 156 MSHPKLLLLDEPSMGLSPIMVEKIFEVIRN-VSAQGITILLVEQNAKLALEAAHRGYVME 214 Query: 61 RGRIVHASDSQSLLDD 76 G I +Q +LDD Sbjct: 215 SGLITMQGQAQQMLDD 230 >gi|300309522|ref|YP_003773614.1| branched-chain amino acid ABC transporter ATPase [Herbaspirillum seropedicae SmR1] Length = 241 Score = 69.3 bits (168), Expect = 5e-14, Method: Compositional matrix adjust. Identities = 33/76 (43%), Positives = 53/76 (69%), Gaps = 1/76 (1%) Query: 1 MVSPSILLLDEPMEGLAPIIVQELLKVIRRLVSEEGMSVIVVEQHARMALSLTQRAIVLD 60 M P +LLLDEP GL+PI+V+++ +VIR VS +G+++++VEQ+A++AL R V++ Sbjct: 156 MSHPKLLLLDEPSMGLSPIMVEKIFEVIRN-VSAQGITILLVEQNAKLALEAAHRGYVME 214 Query: 61 RGRIVHASDSQSLLDD 76 G I +Q +LDD Sbjct: 215 SGLITMQGQAQQMLDD 230 Database: BlastDatabases/689/689 Posted date: Apr 10, 2011 12:15 AM Number of letters in database: 1,619,870 Number of sequences in database: 4735 Lambda K H 0.321 0.136 0.353 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 4735 Number of Hits to DB: 236,837 Number of extensions: 7544 Number of successful extensions: 189 Number of sequences better than 1.0e-08: 19 Number of HSP's gapped: 193 Number of HSP's successfully gapped: 19 Length of query: 87 Length of database: 1,619,870 Length adjustment: 57 Effective length of query: 30 Effective length of database: 1,349,975 Effective search space: 40499250 Effective search space used: 40499250 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 123 (52.0 bits)