BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0022.0010.p (125 letters) Database: BlastDatabases/689/689 4735 sequences; 1,619,870 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|300310994|ref|YP_003775086.1| branched-chain amino acid ABC t... 255 6e-70 gi|300310285|ref|YP_003774377.1| branched-chain amino acid ABC t... 124 3e-30 gi|300312239|ref|YP_003776331.1| amino acid ABC transporter ATPa... 119 1e-28 gi|300311881|ref|YP_003775973.1| amino acid ABC transporter ATPa... 118 1e-28 gi|300313405|ref|YP_003777497.1| branched-chain amino acid ABC t... 117 2e-28 >gi|300310994|ref|YP_003775086.1| branched-chain amino acid ABC transporter ATPase [Herbaspirillum seropedicae SmR1] Length = 258 Score = 255 bits (652), Expect = 6e-70, Method: Compositional matrix adjust. Identities = 125/125 (100%), Positives = 125/125 (100%) Query: 1 LQRAAYWLDQLGLTALANREAGTLSYGLQRRVEIARCMITKPRLLLLDEPAAGLNPQEKQ 60 LQRAAYWLDQLGLTALANREAGTLSYGLQRRVEIARCMITKPRLLLLDEPAAGLNPQEKQ Sbjct: 134 LQRAAYWLDQLGLTALANREAGTLSYGLQRRVEIARCMITKPRLLLLDEPAAGLNPQEKQ 193 Query: 61 ELSQLIDRLRREHGVAVLLIEHDMSLIMGISDRILVMEHGKPIVTGTPEQVRSDERVIKA 120 ELSQLIDRLRREHGVAVLLIEHDMSLIMGISDRILVMEHGKPIVTGTPEQVRSDERVIKA Sbjct: 194 ELSQLIDRLRREHGVAVLLIEHDMSLIMGISDRILVMEHGKPIVTGTPEQVRSDERVIKA 253 Query: 121 YLGEE 125 YLGEE Sbjct: 254 YLGEE 258 >gi|300310285|ref|YP_003774377.1| branched-chain amino acid ABC transporter ATPase [Herbaspirillum seropedicae SmR1] Length = 263 Score = 124 bits (310), Expect = 3e-30, Method: Compositional matrix adjust. Identities = 58/113 (51%), Positives = 77/113 (68%) Query: 11 LGLTALANREAGTLSYGLQRRVEIARCMITKPRLLLLDEPAAGLNPQEKQELSQLIDRLR 70 L L A A R+ G L YGLQ+RVE+AR ++ +PRLLLLDEP AG+ EK E++ + R Sbjct: 144 LDLRAYAERQVGGLPYGLQKRVELARALVARPRLLLLDEPMAGMTVTEKSEMADFVRAAR 203 Query: 71 REHGVAVLLIEHDMSLIMGISDRILVMEHGKPIVTGTPEQVRSDERVIKAYLG 123 + A+LLIEHD+ L+ G+SDR++V+ HG I G P VR D VI+AYLG Sbjct: 204 DQFDTAILLIEHDIGLVFGLSDRVVVLHHGSKIADGAPAAVRQDAAVIEAYLG 256 >gi|300312239|ref|YP_003776331.1| amino acid ABC transporter ATPase [Herbaspirillum seropedicae SmR1] Length = 253 Score = 119 bits (297), Expect = 1e-28, Method: Compositional matrix adjust. Identities = 59/124 (47%), Positives = 85/124 (68%), Gaps = 1/124 (0%) Query: 2 QRAAYWLDQLGLTALANREAGTLSYGLQRRVEIARCMITKPRLLLLDEPAAGLNPQEKQE 61 +RA L + L A+ A +LSYG QR++E AR + TKP+LLLLDEP AG+NP EK E Sbjct: 129 ERALELLSWVRLDHKAHMLADSLSYGEQRKLEFARALATKPKLLLLDEPVAGMNPAEKTE 188 Query: 62 LSQLIDRLRREHGVAVLLIEHDMSLIMGISDRILVMEHGKPIVTGTPEQVRSDERVIKAY 121 L I + ++ G + +IEHDM +MG+ +RI V+ GK I GTP+Q+++++ VI+AY Sbjct: 189 LMSEIVNI-KQRGFTIFMIEHDMRFVMGLCERIAVLNFGKIIAEGTPDQIKNNQEVIEAY 247 Query: 122 LGEE 125 LG+E Sbjct: 248 LGKE 251 >gi|300311881|ref|YP_003775973.1| amino acid ABC transporter ATPase [Herbaspirillum seropedicae SmR1] Length = 293 Score = 118 bits (296), Expect = 1e-28, Method: Compositional matrix adjust. Identities = 56/116 (48%), Positives = 82/116 (70%) Query: 8 LDQLGLTALANREAGTLSYGLQRRVEIARCMITKPRLLLLDEPAAGLNPQEKQELSQLID 67 +D L + + G L YGLQ+RVE+AR + +P +LLLDEP AG+N +EKQ++ + I Sbjct: 175 IDFLEIQHIRKTPVGRLPYGLQKRVELARALAAEPHMLLLDEPMAGMNVEEKQDMCRFIL 234 Query: 68 RLRREHGVAVLLIEHDMSLIMGISDRILVMEHGKPIVTGTPEQVRSDERVIKAYLG 123 + + G ++LIEHDM ++M ISDR++V+++GK I GTPE+V +E VIKAYLG Sbjct: 235 DVNDQFGTTIVLIEHDMGVVMDISDRVVVLDYGKKIGDGTPEEVMGNEDVIKAYLG 290 >gi|300313405|ref|YP_003777497.1| branched-chain amino acid ABC transporter ATP-binding protein/permease [Herbaspirillum seropedicae SmR1] Length = 596 Score = 117 bits (294), Expect = 2e-28, Method: Compositional matrix adjust. Identities = 61/116 (52%), Positives = 84/116 (72%), Gaps = 1/116 (0%) Query: 8 LDQLGLTALANREAGTLSYGLQRRVEIARCMITKPRLLLLDEPAAGLNPQEKQELSQLID 67 L+++GL L +R AG+L+ G QR +EIAR + P LLLLDEPAAGL +EK+ L+ L+D Sbjct: 479 LERVGLGDLVDRPAGSLALGQQRILEIARALCCDPALLLLDEPAAGLRLKEKEALAALLD 538 Query: 68 RLRREHGVAVLLIEHDMSLIMGISDRILVMEHGKPIVTGTPEQVRSDERVIKAYLG 123 +LR E G+AVLL+EHDM +M ++D I+VME G I GTP Q++ V++AYLG Sbjct: 539 KLRGE-GMAVLLVEHDMDFVMQLTDHIVVMEFGAKIAEGTPAQIQVHPAVLEAYLG 593 Database: BlastDatabases/689/689 Posted date: Apr 10, 2011 12:15 AM Number of letters in database: 1,619,870 Number of sequences in database: 4735 Lambda K H 0.320 0.138 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 4735 Number of Hits to DB: 400,126 Number of extensions: 15120 Number of successful extensions: 279 Number of sequences better than 1.0e-08: 105 Number of HSP's gapped: 241 Number of HSP's successfully gapped: 115 Length of query: 125 Length of database: 1,619,870 Length adjustment: 75 Effective length of query: 50 Effective length of database: 1,264,745 Effective search space: 63237250 Effective search space used: 63237250 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 125 (52.8 bits)