BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0011.0035.p (131 letters) Database: BlastDatabases/689/689 4735 sequences; 1,619,870 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|300313630|ref|YP_003777722.1| LysR family transcription regul... 84 3e-18 gi|300313187|ref|YP_003777279.1| transcription regulator protein... 73 6e-15 gi|300311443|ref|YP_003775535.1| LysR family transcription regul... 72 2e-14 gi|300312018|ref|YP_003776110.1| transcription regulator protein... 69 1e-13 gi|300313746|ref|YP_003777838.1| LysR family transcription regul... 69 1e-13 >gi|300313630|ref|YP_003777722.1| LysR family transcription regulator protein [Herbaspirillum seropedicae SmR1] Length = 310 Score = 84.3 bits (207), Expect = 3e-18, Method: Compositional matrix adjust. Identities = 48/113 (42%), Positives = 70/113 (61%) Query: 6 YNDLLAFLAIAREGSFTRAAAQLGVSQSALSHTIRALEARLGVRLLTRTTRSVSVTQAGE 65 +N+L AF+A+ SF RAA LG+S SALS TIR LE R+G RLL RTTRSV+ + GE Sbjct: 6 FNELKAFVAVVERQSFVRAAEHLGLSPSALSQTIRQLEDRIGARLLNRTTRSVAPSANGE 65 Query: 66 RLVESVGPRFEEIESELAALGQLKEKPAGSIRLTSAEHAANTVLWPKLIKLTE 118 L V P F E+ + +A + + +G +R+ + AA T++ P+L + + Sbjct: 66 LLYRRVAPLFREMAAAVAQASEATGQMSGRLRINTLGIAARTIIAPRLARFHQ 118 >gi|300313187|ref|YP_003777279.1| transcription regulator protein [Herbaspirillum seropedicae SmR1] Length = 308 Score = 73.2 bits (178), Expect = 6e-15, Method: Compositional matrix adjust. Identities = 40/110 (36%), Positives = 64/110 (58%) Query: 4 ENYNDLLAFLAIAREGSFTRAAAQLGVSQSALSHTIRALEARLGVRLLTRTTRSVSVTQA 63 E + F+A A GSF+ AA QLG++ +A+ + LE+ LGVRL R+TR +S+T+A Sbjct: 2 ETMTSIECFVAAAHAGSFSAAARQLGLTSAAVGKNVARLESSLGVRLFHRSTRKLSLTEA 61 Query: 64 GERLVESVGPRFEEIESELAALGQLKEKPAGSIRLTSAEHAANTVLWPKL 113 GER ++ VG + I S +A L +PAG+++++ + P L Sbjct: 62 GERFLQEVGGGLQAIRSAVANLASAGGQPAGTLKVSMGTGFGRQYIVPLL 111 >gi|300311443|ref|YP_003775535.1| LysR family transcription regulator protein [Herbaspirillum seropedicae SmR1] Length = 324 Score = 72.0 bits (175), Expect = 2e-14, Method: Compositional matrix adjust. Identities = 36/96 (37%), Positives = 60/96 (62%) Query: 5 NYNDLLAFLAIAREGSFTRAAAQLGVSQSALSHTIRALEARLGVRLLTRTTRSVSVTQAG 64 + ND+ F+ + R GSF A +L + + +S +++LEA +GVRLL R+TR +++T AG Sbjct: 3 DLNDIWLFVHVVRAGSFAAAGRRLSMPPNTISRRLQSLEAAMGVRLLQRSTRQLNMTAAG 62 Query: 65 ERLVESVGPRFEEIESELAALGQLKEKPAGSIRLTS 100 E P E+IE A+L + + +PAGS+R+ + Sbjct: 63 REFFERCAPGLEDIEHASASLTESQGEPAGSLRVAA 98 >gi|300312018|ref|YP_003776110.1| transcription regulator protein [Herbaspirillum seropedicae SmR1] Length = 305 Score = 68.9 bits (167), Expect = 1e-13, Method: Compositional matrix adjust. Identities = 45/112 (40%), Positives = 65/112 (58%), Gaps = 6/112 (5%) Query: 5 NYNDLLAFLAIAREGSFTRAAAQLGVSQSALSHTIRALEARLGVRLLTRTTRSVSVTQAG 64 ++DL F+ I R GSF AA QLG++ SA SH ++ LE RL +LL R++R++S T AG Sbjct: 8 EFSDLRVFVTILRTGSFKAAAIQLGLTPSATSHAMKRLEERLATQLLYRSSRAISPTAAG 67 Query: 65 ERLVESVGPRFEEIESELAALGQLKEKPAGS---IRLTSAEHAANTVLWPKL 113 L + FE+I AAL QL AGS +R+ AA+ ++ P + Sbjct: 68 SELAARLEQGFEQIG---AALSQLDSSAAGSLGELRINVFADAAHLLIEPAI 116 >gi|300313746|ref|YP_003777838.1| LysR family transcription regulator protein [Herbaspirillum seropedicae SmR1] Length = 299 Score = 68.9 bits (167), Expect = 1e-13, Method: Compositional matrix adjust. Identities = 47/130 (36%), Positives = 64/130 (49%), Gaps = 7/130 (5%) Query: 7 NDLLAFLAIAR---EGSFTRAAAQLGVSQSALSHTIRALEARLGVRLLTRTTRSVSVTQA 63 + LLA A AR G+FTRAA L + + LS +R LEA LGVRLL RTTR VSVT Sbjct: 2 DQLLAIRAFARVVEAGNFTRAADSLDMPNATLSKLVRELEAHLGVRLLQRTTRRVSVTPE 61 Query: 64 GERLVESVGPRFEEIESELAALGQLKEKPAGSIRLTSAEHAANTVLWPK----LIKLTEL 119 G E G ++E + + P G +R+ A VL P L + ++ Sbjct: 62 GLDYYEKTGRLVRDLEDIDTSFNAARGNPRGKLRIDVGGSTARDVLIPALPDFLARYPDI 121 Query: 120 DLAVGATRSP 129 + +G + P Sbjct: 122 SIDLGVSDRP 131 Database: BlastDatabases/689/689 Posted date: Apr 10, 2011 12:15 AM Number of letters in database: 1,619,870 Number of sequences in database: 4735 Lambda K H 0.315 0.128 0.344 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 4735 Number of Hits to DB: 315,871 Number of extensions: 9151 Number of successful extensions: 132 Number of sequences better than 1.0e-08: 36 Number of HSP's gapped: 132 Number of HSP's successfully gapped: 36 Length of query: 131 Length of database: 1,619,870 Length adjustment: 75 Effective length of query: 56 Effective length of database: 1,264,745 Effective search space: 70825720 Effective search space used: 70825720 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 125 (52.8 bits)