BLASTP 2.2.18 [Mar-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 0007.0154.p
         (48 letters)

Database: BlastDatabases/689/689 
           4735 sequences; 1,619,870 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|300310744|ref|YP_003774836.1| ABC transporter periplasmic/sur...    62   9e-12

>gi|300310744|ref|YP_003774836.1| ABC transporter
          periplasmic/surface lipoprotein [Herbaspirillum
          seropedicae SmR1]
          Length = 365

 Score = 62.0 bits (149), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 39/41 (95%), Positives = 41/41 (100%)

Query: 1  MQNRRDFLKLSGAAALGAAFPLELLAAGPLTVGFIYVGARE 41
          M+NRRDFLKLSGAAALGAAFPLELLAAGPLTVGFIYVGAR+
Sbjct: 1  MKNRRDFLKLSGAAALGAAFPLELLAAGPLTVGFIYVGARD 41


  Database: BlastDatabases/689/689
    Posted date:  Apr 10, 2011 12:15 AM
  Number of letters in database: 1,619,870
  Number of sequences in database:  4735
  
Lambda     K      H
   0.327    0.143    0.445 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 4735
Number of Hits to DB: 57,119
Number of extensions: 495
Number of successful extensions: 5
Number of sequences better than 1.0e-08: 1
Number of HSP's gapped: 5
Number of HSP's successfully gapped: 1
Length of query: 48
Length of database: 1,619,870
Length adjustment: 21
Effective length of query: 27
Effective length of database: 1,520,435
Effective search space: 41051745
Effective search space used: 41051745
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 123 (52.0 bits)