BLASTP 2.2.17 [Aug-26-2007] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= 0001.4100.p (106 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 15,459,386 sequences; 5,307,515,862 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_003776693.1| transmembrane protein [Herbaspirillum serope... 156 9e-37 ref|YP_004753562.1| hypothetical protein CFU_2913 [Collimonas fu... 129 2e-28 ref|YP_001896390.1| hypothetical protein Bphyt_2772 [Burkholderi... 120 6e-26 ref|YP_108563.1| hypothetical protein BPSL1965 [Burkholderia pse... 120 8e-26 ref|YP_001899560.1| hypothetical protein Rpic_1993 [Ralstonia pi... 119 2e-25 >ref|YP_003776693.1| transmembrane protein [Herbaspirillum seropedicae SmR1] gb|ADJ64785.1| transmembrane protein [Herbaspirillum seropedicae SmR1] Length = 106 Score = 156 bits (395), Expect = 9e-37, Method: Composition-based stats. Identities = 95/106 (89%), Positives = 98/106 (92%) Query: 1 MAATLPERHYASFSEFYPTYLSEHAHRVNRQLHFLGSTLALLSLLLLLITHQWWWLAVAL 60 M+ATLPERHYASFSEFYP YL EHAHRVNRQLHFLGSTLALL LLLLL+THQWWWL VAL Sbjct: 1 MSATLPERHYASFSEFYPIYLGEHAHRVNRQLHFLGSTLALLCLLLLLLTHQWWWLGVAL 60 Query: 61 FCGYGFAWVGHFMVEKNQPATFRHPFYSFMGDWVMYWQMLTGQVSF 106 CGYGFAW GHF+VEKNQPAT RHP YSFMGDWVMYWQMLTGQVSF Sbjct: 61 LCGYGFAWAGHFLVEKNQPATLRHPLYSFMGDWVMYWQMLTGQVSF 106 >ref|YP_004753562.1| hypothetical protein CFU_2913 [Collimonas fungivorans Ter331] gb|AEK62739.1| putative membrane protein [Collimonas fungivorans Ter331] Length = 113 Score = 129 bits (324), Expect = 2e-28, Method: Composition-based stats. Identities = 71/103 (68%), Positives = 89/103 (86%) Query: 4 TLPERHYASFSEFYPTYLSEHAHRVNRQLHFLGSTLALLSLLLLLITHQWWWLAVALFCG 63 T+ E+ Y +F+EFYP+YLS+H++R RQLHF+GSTLALLSL+ L++T +WLAVAL CG Sbjct: 11 TVLEKKYETFAEFYPSYLSQHSNRTCRQLHFVGSTLALLSLVALVLTGALYWLAVALVCG 70 Query: 64 YGFAWVGHFMVEKNQPATFRHPFYSFMGDWVMYWQMLTGQVSF 106 YGFAW+GHF+ EKN+PATF+ P YS +GDWVMYWQMLTGQVSF Sbjct: 71 YGFAWIGHFVFEKNRPATFKQPLYSLLGDWVMYWQMLTGQVSF 113 >ref|YP_001896390.1| hypothetical protein Bphyt_2772 [Burkholderia phytofirmans PsJN] gb|ACD17166.1| conserved hypothetical protein [Burkholderia phytofirmans PsJN] Length = 106 Score = 120 bits (301), Expect = 6e-26, Method: Composition-based stats. Identities = 61/106 (57%), Positives = 75/106 (70%) Query: 1 MAATLPERHYASFSEFYPTYLSEHAHRVNRQLHFLGSTLALLSLLLLLITHQWWWLAVAL 60 MA T H+ASF+EFYP YLSEH + V+R+LHF+GS + L + L T W WL A+ Sbjct: 1 MAQTAHTDHFASFAEFYPYYLSEHRNTVSRRLHFVGSLGVIGCLAMALATGDWLWLPAAV 60 Query: 61 FCGYGFAWVGHFMVEKNQPATFRHPFYSFMGDWVMYWQMLTGQVSF 106 CGYGFAWVGHF EKN+PATFRHP YS MGDWVM+ + G++S Sbjct: 61 ICGYGFAWVGHFFFEKNRPATFRHPLYSLMGDWVMFKDICVGKISL 106 >ref|YP_108563.1| hypothetical protein BPSL1965 [Burkholderia pseudomallei K96243] ref|YP_102670.1| hypothetical protein BMA0943 [Burkholderia mallei ATCC 23344] ref|ZP_00441446.1| membrane protein [Burkholderia mallei GB8 horse 4] ref|YP_333264.1| hypothetical protein BURPS1710b_1863 [Burkholderia pseudomallei 1710b] ref|YP_992807.1| hypothetical protein BMASAVP1_A1476 [Burkholderia mallei SAVP1] ref|YP_001026404.1| hypothetical protein BMA10229_A0405 [Burkholderia mallei NCTC 10229] ref|YP_001058727.1| hypothetical protein BURPS668_1686 [Burkholderia pseudomallei 668] ref|YP_001080323.1| hypothetical protein BMA10247_0757 [Burkholderia mallei NCTC 10247] ref|YP_001065980.1| membrane protein [Burkholderia pseudomallei 1106a] ref|ZP_02268713.1| conserved hypothetical protein [Burkholderia mallei PRL-20] ref|ZP_02403113.1| membrane protein [Burkholderia pseudomallei DM98] ref|ZP_02411653.1| membrane protein [Burkholderia pseudomallei 14] ref|ZP_02447782.1| membrane protein [Burkholderia pseudomallei 91] ref|ZP_02471518.1| membrane protein [Burkholderia pseudomallei B7210] ref|ZP_02481986.1| membrane protein [Burkholderia pseudomallei 7894] ref|ZP_02490191.1| membrane protein [Burkholderia pseudomallei NCTC 13177] ref|ZP_02498317.1| membrane protein [Burkholderia pseudomallei 112] ref|ZP_02506338.1| membrane protein [Burkholderia pseudomallei BCC215] ref|ZP_03454854.1| conserved hypothetical protein [Burkholderia pseudomallei 576] ref|YP_002896442.1| membrane protein [Burkholderia pseudomallei MSHR346] ref|ZP_04816786.1| conserved hypothetical protein [Burkholderia pseudomallei 1106b] ref|ZP_04884641.1| conserved hypothetical protein [Burkholderia mallei ATCC 10399] ref|ZP_04886623.1| conserved hypothetical protein [Burkholderia pseudomallei 1655] ref|ZP_04895077.1| conserved hypothetical protein [Burkholderia pseudomallei Pasteur 52237] ref|ZP_04904020.1| conserved hypothetical protein [Burkholderia pseudomallei S13] ref|ZP_04905973.1| conserved hypothetical protein [Burkholderia mallei FMH] ref|ZP_04912277.1| conserved hypothetical protein [Burkholderia mallei JHU] ref|ZP_04949288.1| conserved hypothetical protein [Burkholderia pseudomallei 1710a] ref|ZP_04965311.1| conserved hypothetical protein [Burkholderia pseudomallei 406e] ref|ZP_04974947.1| conserved hypothetical protein [Burkholderia mallei 2002721280] emb|CAH35964.1| putative membrane protein [Burkholderia pseudomallei K96243] gb|AAU49433.1| conserved hypothetical protein [Burkholderia mallei ATCC 23344] gb|ABA50282.1| conserved hypothetical protein [Burkholderia pseudomallei 1710b] gb|ABM50477.1| conserved hypothetical protein [Burkholderia mallei SAVP1] gb|ABN02134.1| conserved hypothetical protein [Burkholderia mallei NCTC 10229] gb|ABN84912.1| conserved hypothetical protein [Burkholderia pseudomallei 668] gb|ABN88909.1| conserved hypothetical protein [Burkholderia pseudomallei 1106a] gb|ABO04157.1| conserved hypothetical protein [Burkholderia mallei NCTC 10247] gb|EDK56277.1| conserved hypothetical protein [Burkholderia mallei FMH] gb|EDK60433.1| conserved hypothetical protein [Burkholderia mallei JHU] gb|EDK85822.1| conserved hypothetical protein [Burkholderia mallei 2002721280] gb|EDO85038.1| conserved hypothetical protein [Burkholderia pseudomallei 406e] gb|EDO91915.1| conserved hypothetical protein [Burkholderia pseudomallei Pasteur 52237] gb|EDP88995.1| conserved hypothetical protein [Burkholderia mallei ATCC 10399] gb|EDS87032.1| conserved hypothetical protein [Burkholderia pseudomallei S13] gb|EDU07607.1| conserved hypothetical protein [Burkholderia pseudomallei 1655] gb|EEC33232.1| conserved hypothetical protein [Burkholderia pseudomallei 576] gb|ACQ96431.1| membrane protein [Burkholderia pseudomallei MSHR346] gb|EEP87317.1| membrane protein [Burkholderia mallei GB8 horse 4] gb|EES27411.1| conserved hypothetical protein [Burkholderia pseudomallei 1106b] gb|EES43655.1| conserved hypothetical protein [Burkholderia mallei PRL-20] gb|EET06307.1| conserved hypothetical protein [Burkholderia pseudomallei 1710a] Length = 106 Score = 120 bits (300), Expect = 8e-26, Method: Composition-based stats. Identities = 61/105 (58%), Positives = 76/105 (72%) Query: 1 MAATLPERHYASFSEFYPTYLSEHAHRVNRQLHFLGSTLALLSLLLLLITHQWWWLAVAL 60 MA + H+ASF+EFYP YL EH H V+R+LHF+GS + L + L T WWWL A+ Sbjct: 1 MAHSAHTEHFASFAEFYPFYLDEHRHLVSRRLHFVGSLGVIGCLAMALATGLWWWLPAAV 60 Query: 61 FCGYGFAWVGHFMVEKNQPATFRHPFYSFMGDWVMYWQMLTGQVS 105 CGYGFAW+GHF EKN+PATFRHP YS MGDWVM+ + TG++S Sbjct: 61 VCGYGFAWIGHFFFEKNRPATFRHPIYSLMGDWVMFKDICTGKIS 105 >ref|YP_001899560.1| hypothetical protein Rpic_1993 [Ralstonia pickettii 12J] gb|ACD27128.1| putative transmembrane protein [Ralstonia pickettii 12J] Length = 105 Score = 119 bits (298), Expect = 2e-25, Method: Composition-based stats. Identities = 62/104 (59%), Positives = 75/104 (72%) Query: 3 ATLPERHYASFSEFYPTYLSEHAHRVNRQLHFLGSTLALLSLLLLLITHQWWWLAVALFC 62 T R + SF+EFYP YLSEH R R+LHF+GST+AL+ L+LL+ T WWL A Sbjct: 2 GTTDTRSFGSFAEFYPYYLSEHRDRTCRRLHFVGSTVALVCLILLVFTGNLWWLLGAAVS 61 Query: 63 GYGFAWVGHFMVEKNQPATFRHPFYSFMGDWVMYWQMLTGQVSF 106 GY FAWVGHF EKN+PATFRHPFYS +GDWVMY + TG++ F Sbjct: 62 GYAFAWVGHFGFEKNRPATFRHPFYSLLGDWVMYRDIWTGKIPF 105