BLASTP 2.2.17 [Aug-26-2007]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= 0001.3873.p         (69 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           15,459,386 sequences; 5,307,515,862 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ref|YP_003039742.1| hypothetical protein PAU_00905 [Photorhabdus...    66   1e-09

>ref|YP_003039742.1| hypothetical protein PAU_00905 [Photorhabdus asymbiotica subsp.
          asymbiotica ATCC 43949]
 emb|CAR67482.1| Hypothetical Protein PA-RVA14-1106 [Photorhabdus asymbiotica
          subsp. asymbiotica ATCC 43949]
 emb|CAQ82997.1| conserved hypothetical protein [Photorhabdus asymbiotica]
          Length = 66

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 36/66 (54%), Positives = 46/66 (69%), Gaps = 1/66 (1%)

Query: 4  MDEVELTAKQAYRAMLNFLEQEYERTKSDDIAGLLSSLSWEITSDA-GPADPGAWQDWMD 62
          MD   +T +QAY+AM  FLE EYE TKSDDI  LL S+ W I  D+ GPADP  W++W+ 
Sbjct: 1  MDNKMITIEQAYKAMFYFLEHEYELTKSDDIGCLLGSMDWTIWDDSTGPADPAMWEEWLA 60

Query: 63 AVKKAI 68
          AVK+ +
Sbjct: 61 AVKRTL 66