BLASTP 2.2.17 [Aug-26-2007] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= 0001.2818.p (188 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 15,459,386 sequences; 5,307,515,862 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_439067.1| hypothetical protein BTH_II0870 [Burkholderia t... 207 6e-52 ref|ZP_02466806.1| hypothetical protein Bpse38_25834 [Burkholder... 206 1e-51 ref|YP_001631056.1| hypothetical protein Bpet2446 [Bordetella pe... 201 3e-50 ref|YP_111503.1| hypothetical protein BPSS1496 [Burkholderia pse... 201 3e-50 ref|ZP_00438900.1| type VI secretion protein, VC_A0110 family [B... 201 4e-50 >ref|YP_439067.1| hypothetical protein BTH_II0870 [Burkholderia thailandensis E264] ref|ZP_02370361.1| hypothetical protein BthaT_05091 [Burkholderia thailandensis TXDOH] ref|ZP_02384270.1| hypothetical protein BthaB_05046 [Burkholderia thailandensis Bt4] ref|ZP_05590437.1| hypothetical protein BthaA_23601 [Burkholderia thailandensis E264] gb|ABC35340.1| Protein of unknown function (DUF770) superfamily [Burkholderia thailandensis E264] Length = 164 Score = 207 bits (527), Expect = 6e-52, Method: Composition-based stats. Identities = 107/164 (65%), Positives = 141/164 (85%) Query: 25 IMADGSVAPKERVNIVYRPATGDAKSEVELPLKLLVVGDYTLRNDDTPIEEMKPVNIDKD 84 + +GSVAPKERVNIVYRPATGDAK+EVELPLK+LV+G+++ +D PIEE+ PVN+DKD Sbjct: 1 MTTNGSVAPKERVNIVYRPATGDAKAEVELPLKVLVLGEFSTADDKPPIEELAPVNVDKD 60 Query: 85 NFNDVLKAQKLSLDLTVPNKLDDKADPDAVLAMNMSFEHINDFTPDAIVDKVPELRQMIA 144 +FNDV+KAQ+L+L L+VPN LDD+A D L++ + FE I DF+PDAIV+ VPEL+Q++A Sbjct: 61 DFNDVMKAQRLTLALSVPNLLDDQAGEDDRLSVALGFESIADFSPDAIVETVPELKQLVA 120 Query: 145 LRDALKALKGPLGNIPDFRKKVQELIEDEGVRARLLSELGIEEK 188 LRDALKALKGPLGNIP FRK++QE++ D+G R +LL ELG++E+ Sbjct: 121 LRDALKALKGPLGNIPGFRKRIQEIVADKGARKQLLDELGLDEQ 164 >ref|ZP_02466806.1| hypothetical protein Bpse38_25834 [Burkholderia thailandensis MSMB43] Length = 164 Score = 206 bits (524), Expect = 1e-51, Method: Composition-based stats. Identities = 105/164 (64%), Positives = 142/164 (86%) Query: 25 IMADGSVAPKERVNIVYRPATGDAKSEVELPLKLLVVGDYTLRNDDTPIEEMKPVNIDKD 84 + +GSVAPKERVNIVYRPATGDAK+EVELPLK+LV+G+++ +D P+EE+ PVN+DKD Sbjct: 1 MTTNGSVAPKERVNIVYRPATGDAKAEVELPLKVLVLGEFSTADDKPPLEELAPVNVDKD 60 Query: 85 NFNDVLKAQKLSLDLTVPNKLDDKADPDAVLAMNMSFEHINDFTPDAIVDKVPELRQMIA 144 +FNDV+KAQ+L L L+VPN LDD+A D LA+ + FE I+DF+PDAIV+ VPEL+Q++A Sbjct: 61 DFNDVMKAQRLRLALSVPNLLDDQAGEDERLAVALGFESIDDFSPDAIVETVPELKQLVA 120 Query: 145 LRDALKALKGPLGNIPDFRKKVQELIEDEGVRARLLSELGIEEK 188 LRDALKALKGPLGNIP FR+++QE++ D+G R +LL+ELG++++ Sbjct: 121 LRDALKALKGPLGNIPGFRRRIQEIVADKGARKQLLTELGLDDQ 164 >ref|YP_001631056.1| hypothetical protein Bpet2446 [Bordetella petrii DSM 12804] emb|CAP42788.1| conserved hypothetical protein [Bordetella petrii] Length = 172 Score = 201 bits (512), Expect = 3e-50, Method: Composition-based stats. Identities = 106/159 (66%), Positives = 135/159 (84%), Gaps = 1/159 (0%) Query: 28 DGSVAPKERVNIVYRPATGDAKSEVELPLKLLVVGDYTLRNDDTPIEEMKPVNIDKDNFN 87 DGSVAPKERVNIVY+PATGDA+ +VELPLK LV+GD+TL+ DTP++E KP+ +DKDNFN Sbjct: 4 DGSVAPKERVNIVYKPATGDAQEQVELPLKQLVLGDFTLQESDTPLDERKPIQVDKDNFN 63 Query: 88 DVLKAQKLSLDLTVPNKLDDKADPDAVLAMNMSFEHINDFTPDAIVDKVPELRQMIALRD 147 DVLKAQ LS+ + VPN+L + + D L + + FE+I DF PDA+V++VPELRQ+I LR+ Sbjct: 64 DVLKAQGLSVTMAVPNRLSE-GESDESLPVTLKFENIRDFEPDALVEQVPELRQLIELRE 122 Query: 148 ALKALKGPLGNIPDFRKKVQELIEDEGVRARLLSELGIE 186 ALK+LKGPLGN+PDFRKK+Q LI+DEG R RLLSELG++ Sbjct: 123 ALKSLKGPLGNLPDFRKKLQALIQDEGARERLLSELGVQ 161 >ref|YP_111503.1| hypothetical protein BPSS1496 [Burkholderia pseudomallei K96243] ref|YP_001063117.1| hypothetical protein BURPS668_A2123 [Burkholderia pseudomallei 668] ref|YP_001076058.1| hypothetical protein BURPS1106A_A2025 [Burkholderia pseudomallei 1106a] ref|ZP_01768754.1| conserved hypothetical protein [Burkholderia pseudomallei 305] ref|ZP_02407399.1| hypothetical protein BpseD_34415 [Burkholderia pseudomallei DM98] ref|ZP_02415913.1| hypothetical protein Bpse14_34002 [Burkholderia pseudomallei 14] ref|ZP_02451988.1| hypothetical protein Bpse9_34607 [Burkholderia pseudomallei 91] ref|ZP_02494288.1| hypothetical protein BpseN_32935 [Burkholderia pseudomallei NCTC 13177] ref|ZP_02502523.1| hypothetical protein Bpse112_33446 [Burkholderia pseudomallei 112] ref|ZP_02510367.1| hypothetical protein BpseBC_32267 [Burkholderia pseudomallei BCC215] ref|ZP_04812131.1| conserved hypothetical protein [Burkholderia pseudomallei 1106b] ref|ZP_04893332.1| conserved hypothetical protein [Burkholderia pseudomallei Pasteur 52237] emb|CAH38969.1| conserved hypothetical protein [Burkholderia pseudomallei K96243] gb|ABN88352.1| conserved hypothetical protein [Burkholderia pseudomallei 668] gb|ABN92775.1| conserved hypothetical protein [Burkholderia pseudomallei 1106a] gb|EBA46665.1| conserved hypothetical protein [Burkholderia pseudomallei 305] gb|EDO90170.1| conserved hypothetical protein [Burkholderia pseudomallei Pasteur 52237] gb|EES22756.1| conserved hypothetical protein [Burkholderia pseudomallei 1106b] Length = 164 Score = 201 bits (512), Expect = 3e-50, Method: Composition-based stats. Identities = 101/164 (61%), Positives = 139/164 (84%) Query: 25 IMADGSVAPKERVNIVYRPATGDAKSEVELPLKLLVVGDYTLRNDDTPIEEMKPVNIDKD 84 + +GSVAPKERVNIVYRPATGDA++EVELPLK+LV+G+++ D P+EE+ PVN+DKD Sbjct: 1 MTTNGSVAPKERVNIVYRPATGDAQAEVELPLKVLVLGEFSTAADKPPLEELSPVNVDKD 60 Query: 85 NFNDVLKAQKLSLDLTVPNKLDDKADPDAVLAMNMSFEHINDFTPDAIVDKVPELRQMIA 144 +FNDV++AQ L L L+VPN LDD+A D L++ + F+ ++DF+PDAIV+KVPEL+Q+IA Sbjct: 61 DFNDVMRAQNLQLTLSVPNLLDDQAGEDDRLSVTLGFDSVHDFSPDAIVEKVPELKQLIA 120 Query: 145 LRDALKALKGPLGNIPDFRKKVQELIEDEGVRARLLSELGIEEK 188 LRDALKALK P+GNIP FR+++QE++ D+G R +LL ELG++E+ Sbjct: 121 LRDALKALKSPIGNIPGFRRRIQEIVADKGARKQLLDELGLDEQ 164 >ref|ZP_00438900.1| type VI secretion protein, VC_A0110 family [Burkholderia mallei GB8 horse 4] ref|YP_335693.1| hypothetical protein BURPS1710b_A0533 [Burkholderia pseudomallei 1710b] ref|YP_338393.1| hypothetical protein BMAA0744 [Burkholderia mallei ATCC 23344] ref|YP_990212.1| hypothetical protein BMASAVP1_0604 [Burkholderia mallei SAVP1] ref|YP_001024530.1| hypothetical protein BMA10229_0715 [Burkholderia mallei NCTC 10229] ref|YP_001078855.1| hypothetical protein BMA10247_A1672 [Burkholderia mallei NCTC 10247] ref|ZP_02269530.1| conserved hypothetical protein [Burkholderia mallei PRL-20] ref|ZP_02460152.1| hypothetical protein Bpseu9_33659 [Burkholderia pseudomallei 9] ref|ZP_02486148.1| hypothetical protein Bpse7_33751 [Burkholderia pseudomallei 7894] ref|ZP_03456644.1| conserved hypothetical protein [Burkholderia pseudomallei 576] ref|ZP_03791618.1| conserved hypothetical protein [Burkholderia pseudomallei Pakistan 9] ref|ZP_04522857.1| type VI secretion protein, VC_A0110 family [Burkholderia pseudomallei MSHR346] ref|ZP_04881004.1| conserved hypothetical protein [Burkholderia mallei ATCC 10399] ref|ZP_04891802.1| conserved hypothetical protein [Burkholderia pseudomallei 1655] ref|ZP_04900905.1| conserved hypothetical protein [Burkholderia pseudomallei S13] ref|ZP_04910543.1| conserved hypothetical protein [Burkholderia mallei FMH] ref|ZP_04915505.1| conserved hypothetical protein [Burkholderia mallei JHU] ref|ZP_04954106.1| conserved hypothetical protein [Burkholderia pseudomallei 1710a] ref|ZP_04968942.1| conserved hypothetical protein [Burkholderia pseudomallei 406e] ref|ZP_04971837.1| conserved hypothetical protein [Burkholderia mallei 2002721280] gb|AAY59319.1| conserved hypothetical protein [Burkholderia mallei ATCC 23344] gb|ABA52260.1| conserved hypothetical protein [Burkholderia pseudomallei 1710b] gb|ABM49394.1| conserved hypothetical protein [Burkholderia mallei SAVP1] gb|ABM99218.1| conserved hypothetical protein [Burkholderia mallei NCTC 10229] gb|ABO02067.1| conserved hypothetical protein [Burkholderia mallei NCTC 10247] gb|EDK52149.1| conserved hypothetical protein [Burkholderia mallei FMH] gb|EDK57451.1| conserved hypothetical protein [Burkholderia mallei JHU] gb|EDK82712.1| conserved hypothetical protein [Burkholderia mallei 2002721280] tpg|DAA06012.1| TPA_exp: TssA [Burkholderia mallei] gb|EDO88196.1| conserved hypothetical protein [Burkholderia pseudomallei 406e] gb|EDP85358.1| conserved hypothetical protein [Burkholderia mallei ATCC 10399] gb|EDS83917.1| conserved hypothetical protein [Burkholderia pseudomallei S13] gb|EDU12786.1| conserved hypothetical protein [Burkholderia pseudomallei 1655] gb|EEC31781.1| conserved hypothetical protein [Burkholderia pseudomallei 576] gb|EEH27926.1| conserved hypothetical protein [Burkholderia pseudomallei Pakistan 9] gb|EEP51771.1| type VI secretion protein, VC_A0110 family [Burkholderia pseudomallei MSHR346] gb|EEP84189.1| type VI secretion protein, VC_A0110 family [Burkholderia mallei GB8 horse 4] gb|EES42948.1| conserved hypothetical protein [Burkholderia mallei PRL-20] gb|EET03628.1| conserved hypothetical protein [Burkholderia pseudomallei 1710a] Length = 164 Score = 201 bits (511), Expect = 4e-50, Method: Composition-based stats. Identities = 101/164 (61%), Positives = 139/164 (84%) Query: 25 IMADGSVAPKERVNIVYRPATGDAKSEVELPLKLLVVGDYTLRNDDTPIEEMKPVNIDKD 84 + +GSVAPKERVNIVYRPATGDA++EVELPLK+LV+G+++ D P+EE+ PVN+DKD Sbjct: 1 MTTNGSVAPKERVNIVYRPATGDAQAEVELPLKVLVLGEFSTAADKPPLEELSPVNVDKD 60 Query: 85 NFNDVLKAQKLSLDLTVPNKLDDKADPDAVLAMNMSFEHINDFTPDAIVDKVPELRQMIA 144 +FNDV++AQ L L L+VPN LDD+A D L++ + F+ ++DF+PDAIV+KVPEL+Q+IA Sbjct: 61 DFNDVMRAQNLQLALSVPNLLDDQAGEDDRLSVTLGFDSVHDFSPDAIVEKVPELKQLIA 120 Query: 145 LRDALKALKGPLGNIPDFRKKVQELIEDEGVRARLLSELGIEEK 188 LRDALKALK P+GNIP FR+++QE++ D+G R +LL ELG++E+ Sbjct: 121 LRDALKALKSPIGNIPGFRRRIQEIVADKGARKQLLDELGLDEQ 164