BLASTP 2.2.17 [Aug-26-2007] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= 0001.2152.p (124 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 15,459,386 sequences; 5,307,515,862 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_004752245.1| preprotein translocase IISp family, auxillar... 112 1e-23 ref|YP_001100107.1| IISP family preprotein translocase auxillary... 111 3e-23 ref|YP_001353151.1| preprotein translocase SecG subunit [Janthin... 107 9e-22 ref|YP_441613.1| preprotein translocase subunit SecG [Burkholder... 97 6e-19 ref|YP_107832.1| preprotein translocase subunit SecG [Burkholder... 97 6e-19 >ref|YP_004752245.1| preprotein translocase IISp family, auxillary membrane component [Collimonas fungivorans Ter331] gb|AEK61422.1| preprotein translocase IISP family, auxillary membrane component [Collimonas fungivorans Ter331] Length = 146 Score = 112 bits (281), Expect = 1e-23, Method: Composition-based stats. Identities = 69/91 (75%), Positives = 81/91 (89%) Query: 1 MNTLFLVVVVVQVLAALAIIGLVLLQHGKGADMGAAFGSGASGSLFGATGSSNFLSKSTA 60 MNT+F ++V+VQVL+AL IIGLVLLQHGKGADMGAAFGSGASGSLFGATGSSNFLSKST Sbjct: 1 MNTVFNIIVIVQVLSALTIIGLVLLQHGKGADMGAAFGSGASGSLFGATGSSNFLSKSTG 60 Query: 61 VAAGIFFVATLGLTFIGNHHTAQSGSVMDNL 91 AA +FF+ATL L ++GNH +A +G VM+NL Sbjct: 61 AAAALFFIATLALVYLGNHRSAVTGGVMENL 91 >ref|YP_001100107.1| IISP family preprotein translocase auxillary membrane component [Herminiimonas arsenicoxydans] emb|CAL61982.1| Preprotein translocase SecG subunit [Herminiimonas arsenicoxydans] Length = 132 Score = 111 bits (278), Expect = 3e-23, Method: Composition-based stats. Identities = 83/136 (61%), Positives = 94/136 (69%), Gaps = 16/136 (11%) Query: 1 MNTLFLVVVVVQVLAALAIIGLVLLQHGKGADMGAAFGSGASGSLFGATGSSNFLSKSTA 60 MN+L ++VVVQVL+AL IIGLVLLQHGKGADMGA+FGSGASGSLFGATGSSNFLSK T Sbjct: 1 MNSLHTIIVVVQVLSALTIIGLVLLQHGKGADMGASFGSGASGSLFGATGSSNFLSKFTG 60 Query: 61 VAAGIFFVATLGLTFIGNHHTAQSGSVMDNLQAPAVPAQQAA------------PAAPAA 108 VAA IFF ATLGL FI N S VM+NL AVP + P APA+ Sbjct: 61 VAAAIFFAATLGLAFISNKPAQTSAGVMENLPVSAVPGAETKSAEVPGAPANVQPVAPAS 120 Query: 109 PTEAAKPGDQSNQIPK 124 P+E + +NQIPK Sbjct: 121 PSEK----EHANQIPK 132 >ref|YP_001353151.1| preprotein translocase SecG subunit [Janthinobacterium sp. Marseille] gb|ABR88605.1| preprotein translocase SecG subunit [Janthinobacterium sp. Marseille] Length = 128 Score = 107 bits (266), Expect = 9e-22, Method: Composition-based stats. Identities = 85/132 (64%), Positives = 92/132 (69%), Gaps = 12/132 (9%) Query: 1 MNTLFLVVVVVQVLAALAIIGLVLLQHGKGADMGAAFGSGASGSLFGATGSSNFLSKSTA 60 MN+ ++VVVQVL+AL IIGLVLLQHGKGADMGA+FGSGASGSLFGATGSSNFLSK T Sbjct: 1 MNSFHTIIVVVQVLSALTIIGLVLLQHGKGADMGASFGSGASGSLFGATGSSNFLSKFTG 60 Query: 61 VAAGIFFVATLGLTFIGNHHTAQSGSVMDNLQAPAVPAQQAAPA--------APAAPTEA 112 VAA IFF ATLGL FIGN S VM+NL A AVP A P AP + Sbjct: 61 VAAVIFFSATLGLAFIGNKPATPSAGVMENLPASAVPGAAAPAQTAPAAAPETPVAPGGS 120 Query: 113 AKPGDQSNQIPK 124 A QSNQIPK Sbjct: 121 A----QSNQIPK 128 >ref|YP_441613.1| preprotein translocase subunit SecG [Burkholderia thailandensis E264] ref|ZP_02373295.1| preprotein translocase subunit SecG [Burkholderia thailandensis TXDOH] ref|ZP_02387161.1| preprotein translocase subunit SecG [Burkholderia thailandensis Bt4] ref|ZP_05587953.1| preprotein translocase subunit SecG [Burkholderia thailandensis E264] gb|ABC36937.1| Preprotein translocase SecG subunit, putative [Burkholderia thailandensis E264] Length = 125 Score = 97.4 bits (241), Expect = 6e-19, Method: Composition-based stats. Identities = 61/88 (69%), Positives = 77/88 (87%) Query: 1 MNTLFLVVVVVQVLAALAIIGLVLLQHGKGADMGAAFGSGASGSLFGATGSSNFLSKSTA 60 M L ++++VVQ+L+AL +IGLVLLQHGKGADMGAAFGSGASGSLFGATGS+NFLS++TA Sbjct: 1 MPYLKVLIIVVQLLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTA 60 Query: 61 VAAGIFFVATLGLTFIGNHHTAQSGSVM 88 V A IFFVATL LT++G++ +A S V+ Sbjct: 61 VLATIFFVATLALTYLGSYKSAPSVGVL 88 >ref|YP_107832.1| preprotein translocase subunit SecG [Burkholderia pseudomallei K96243] ref|YP_103435.1| preprotein translocase subunit SecG [Burkholderia mallei ATCC 23344] ref|ZP_00440953.1| preprotein translocase, SecG subunit [Burkholderia mallei GB8 horse 4] ref|YP_332843.1| preprotein translocase subunit SecG [Burkholderia pseudomallei 1710b] ref|YP_992468.1| preprotein translocase subunit SecG [Burkholderia mallei SAVP1] ref|YP_001026729.1| preprotein translocase subunit SecG [Burkholderia mallei NCTC 10229] ref|YP_001058337.1| preprotein translocase subunit SecG [Burkholderia pseudomallei 668] ref|YP_001079986.1| preprotein translocase subunit SecG [Burkholderia mallei NCTC 10247] ref|YP_001065576.1| preprotein translocase subunit SecG [Burkholderia pseudomallei 1106a] ref|ZP_01770658.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei 305] ref|ZP_02266187.1| preprotein translocase, SecG subunit [Burkholderia mallei PRL-20] ref|ZP_02454922.1| preprotein translocase subunit SecG [Burkholderia pseudomallei 9] ref|ZP_02480946.1| preprotein translocase subunit SecG [Burkholderia pseudomallei 7894] ref|ZP_02497317.1| preprotein translocase subunit SecG [Burkholderia pseudomallei 112] ref|ZP_02505350.1| preprotein translocase subunit SecG [Burkholderia pseudomallei BCC215] ref|ZP_03451459.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei 576] ref|ZP_03790977.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei Pakistan 9] ref|YP_002896032.1| preprotein translocase subunit SecG [Burkholderia pseudomallei MSHR346] ref|ZP_04813819.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei 1106b] ref|ZP_04882052.1| preprotein translocase, SecG subunit [Burkholderia mallei ATCC 10399] ref|ZP_04887785.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei 1655] ref|ZP_04897058.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei Pasteur 52237] ref|ZP_04901521.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei S13] ref|ZP_04908474.1| preprotein translocase, SecG subunit [Burkholderia mallei FMH] ref|ZP_04913791.1| preprotein translocase, SecG subunit [Burkholderia mallei JHU] ref|ZP_04951298.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei 1710a] ref|ZP_04965984.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei 406e] ref|ZP_04976133.1| preprotein translocase, SecG subunit [Burkholderia mallei 2002721280] emb|CAH35205.1| general secretory pathway, protein-export membrane protein [Burkholderia pseudomallei K96243] gb|AAU49842.1| preprotein translocase, SecG subunit [Burkholderia mallei ATCC 23344] gb|ABA49530.1| Preprotein translocase SecG subunit, putative [Burkholderia pseudomallei 1710b] gb|ABM51312.1| preprotein translocase, SecG subunit [Burkholderia mallei SAVP1] gb|ABN01318.1| preprotein translocase, SecG subunit [Burkholderia mallei NCTC 10229] gb|ABN84686.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei 668] gb|ABN89126.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei 1106a] gb|ABO04668.1| preprotein translocase, SecG subunit [Burkholderia mallei NCTC 10247] gb|EBA44849.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei 305] gb|EDK53435.1| preprotein translocase, SecG subunit [Burkholderia mallei FMH] gb|EDK58402.1| preprotein translocase, SecG subunit [Burkholderia mallei JHU] gb|EDK87008.1| preprotein translocase, SecG subunit [Burkholderia mallei 2002721280] gb|EDO85366.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei 406e] gb|EDO93896.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei Pasteur 52237] gb|EDP86406.1| preprotein translocase, SecG subunit [Burkholderia mallei ATCC 10399] gb|EDS84533.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei S13] gb|EDU08769.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei 1655] gb|EEC37273.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei 576] gb|EEH28588.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei Pakistan 9] gb|ACQ95556.1| preprotein translocase subunit SecG [Burkholderia pseudomallei MSHR346] gb|EEP86728.1| preprotein translocase, SecG subunit [Burkholderia mallei GB8 horse 4] gb|EES24444.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei 1106b] gb|EES45889.1| preprotein translocase, SecG subunit [Burkholderia mallei PRL-20] gb|EET08317.1| preprotein translocase, SecG subunit [Burkholderia pseudomallei 1710a] Length = 125 Score = 97.4 bits (241), Expect = 6e-19, Method: Composition-based stats. Identities = 61/88 (69%), Positives = 77/88 (87%) Query: 1 MNTLFLVVVVVQVLAALAIIGLVLLQHGKGADMGAAFGSGASGSLFGATGSSNFLSKSTA 60 M L ++++VVQ+L+AL +IGLVLLQHGKGADMGAAFGSGASGSLFGATGS+NFLS++TA Sbjct: 1 MPYLKVLIIVVQLLSALGVIGLVLLQHGKGADMGAAFGSGASGSLFGATGSANFLSRTTA 60 Query: 61 VAAGIFFVATLGLTFIGNHHTAQSGSVM 88 V A IFFVATL LT++G++ +A S V+ Sbjct: 61 VLATIFFVATLALTYLGSYKSAPSVGVL 88