BLASTP 2.2.17 [Aug-26-2007] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= 0001.1840.p (93 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 15,459,386 sequences; 5,307,515,862 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_004294969.1| hypothetical protein NAL212_1969 [Nitrosomon... 96 1e-18 ref|YP_003643658.1| hypothetical protein Tint_1966 [Thiomonas in... 90 1e-16 ref|YP_439238.1| hypothetical protein BTH_II1041 [Burkholderia t... 86 1e-15 ref|YP_110416.1| hypothetical protein BPSS0394 [Burkholderia pse... 86 2e-15 ref|ZP_04522224.1| conserved hypothetical protein [Burkholderia ... 85 3e-15 >ref|YP_004294969.1| hypothetical protein NAL212_1969 [Nitrosomonas sp. AL212] gb|ADZ26807.1| hypothetical protein NAL212_1969 [Nitrosomonas sp. AL212] Length = 95 Score = 96.3 bits (238), Expect = 1e-18, Method: Composition-based stats. Identities = 48/79 (60%), Positives = 60/79 (75%), Gaps = 2/79 (2%) Query: 14 EEDAAITAAALSDPDNPPLTAEDFAAMRPARGRGRPAGSGTKVQVTMRFDIDVLEAFKSE 73 EEDA ITAAAL+DPDNPPLT E+ + R RGRP GSG K QVT+R D ++LE F++ Sbjct: 19 EEDAQITAAALTDPDNPPLTDEELQQFK--RARGRPQGSGKKEQVTLRIDTEILEQFRAT 76 Query: 74 GAGWQSRMNGALREWLAQH 92 G GWQ+R+N ALR+W+ QH Sbjct: 77 GNGWQTRINDALRDWIKQH 95 >ref|YP_003643658.1| hypothetical protein Tint_1966 [Thiomonas intermedia K12] gb|ADG31328.1| conserved hypothetical protein [Thiomonas intermedia K12] Length = 111 Score = 90.1 bits (222), Expect = 1e-16, Method: Composition-based stats. Identities = 53/107 (49%), Positives = 65/107 (60%), Gaps = 15/107 (14%) Query: 1 MPKIKQGALPPGDEEDAAITAAALSDPDNPPLTAEDFAAMRPA---------------RG 45 MPK+K G + P EEDAAI A ++DPDNP TAEDFA +PA R Sbjct: 1 MPKLKTGTIYPTQEEDAAINAGIVADPDNPEWTAEDFARAKPASEALPPEMYAALVAKRP 60 Query: 46 RGRPAGSGTKVQVTMRFDIDVLEAFKSEGAGWQSRMNGALREWLAQH 92 RGRP TKV +R D D+LE FKS G GWQ+R+N ALR++L +H Sbjct: 61 RGRPKADETKVFTAIRLDADLLETFKSTGKGWQTRVNAALRQYLNEH 107 >ref|YP_439238.1| hypothetical protein BTH_II1041 [Burkholderia thailandensis E264] gb|ABC36093.1| pANL12 [Burkholderia thailandensis E264] Length = 94 Score = 86.3 bits (212), Expect = 1e-15, Method: Composition-based stats. Identities = 46/89 (51%), Positives = 61/89 (68%) Query: 5 KQGALPPGDEEDAAITAAALSDPDNPPLTAEDFAAMRPARGRGRPAGSGTKVQVTMRFDI 64 K+ + P DEEDAAI +DPD + AEDFA M RGRP KVQ+T+R+D+ Sbjct: 4 KRKIVMPTDEEDAAINRGIAADPDTFEVPAEDFAKMTRRGKRGRPPLEAPKVQLTVRYDV 63 Query: 65 DVLEAFKSEGAGWQSRMNGALREWLAQHR 93 D+++AFK+ G GWQ+RMN ALREWL +H+ Sbjct: 64 DIVDAFKATGEGWQTRMNDALREWLKEHQ 92 >ref|YP_110416.1| hypothetical protein BPSS0394 [Burkholderia pseudomallei K96243] ref|YP_337094.1| hypothetical protein BURPS1710b_A1943 [Burkholderia pseudomallei 1710b] ref|YP_001074579.1| hypothetical protein BURPS1106A_A0543 [Burkholderia pseudomallei 1106a] ref|ZP_02405691.1| hypothetical protein BpseD_25809 [Burkholderia pseudomallei DM98] ref|ZP_02450302.1| hypothetical protein Bpse9_26053 [Burkholderia pseudomallei 91] ref|ZP_02458470.1| hypothetical protein Bpseu9_25210 [Burkholderia pseudomallei 9] ref|ZP_02476977.1| hypothetical protein BpseB_39918 [Burkholderia pseudomallei B7210] ref|ZP_02484475.1| hypothetical protein Bpse7_25282 [Burkholderia pseudomallei 7894] ref|ZP_02492657.1| hypothetical protein BpseN_24641 [Burkholderia pseudomallei NCTC 13177] ref|ZP_02500848.1| hypothetical protein Bpse112_24952 [Burkholderia pseudomallei 112] ref|ZP_03455929.1| conserved hypothetical protein [Burkholderia pseudomallei 576] ref|ZP_04812428.1| conserved hypothetical protein [Burkholderia pseudomallei 1106b] ref|ZP_04891905.1| conserved hypothetical protein [Burkholderia pseudomallei 1655] ref|ZP_04953284.1| conserved hypothetical protein [Burkholderia pseudomallei 1710a] ref|ZP_04964257.1| conserved hypothetical protein [Burkholderia pseudomallei 406e] emb|CAH37846.1| conserved hypothetical protein [Burkholderia pseudomallei K96243] gb|ABA53606.1| pANL12 [Burkholderia pseudomallei 1710b] gb|ABN94610.1| conserved hypothetical protein [Burkholderia pseudomallei 1106a] gb|EDO83907.1| conserved hypothetical protein [Burkholderia pseudomallei 406e] gb|EDU06595.1| conserved hypothetical protein [Burkholderia pseudomallei 1655] gb|EEC32379.1| conserved hypothetical protein [Burkholderia pseudomallei 576] gb|EES23053.1| conserved hypothetical protein [Burkholderia pseudomallei 1106b] gb|EET02806.1| conserved hypothetical protein [Burkholderia pseudomallei 1710a] Length = 94 Score = 85.9 bits (211), Expect = 2e-15, Method: Composition-based stats. Identities = 46/89 (51%), Positives = 61/89 (68%) Query: 5 KQGALPPGDEEDAAITAAALSDPDNPPLTAEDFAAMRPARGRGRPAGSGTKVQVTMRFDI 64 K+ + P DEEDAAI +DPD + AEDFA M RGRP KVQ+T+R+D+ Sbjct: 4 KRKIVMPTDEEDAAINRGIAADPDTFEVPAEDFAKMTRRGKRGRPPLEAPKVQLTVRYDV 63 Query: 65 DVLEAFKSEGAGWQSRMNGALREWLAQHR 93 D+++AFK+ G GWQ+RMN ALREWL +H+ Sbjct: 64 DIVDAFKATGEGWQTRMNDALREWLREHQ 92 >ref|ZP_04522224.1| conserved hypothetical protein [Burkholderia pseudomallei MSHR346] ref|ZP_05590621.1| hypothetical protein BthaA_24526 [Burkholderia thailandensis E264] gb|EEP51138.1| conserved hypothetical protein [Burkholderia pseudomallei MSHR346] Length = 86 Score = 85.1 bits (209), Expect = 3e-15, Method: Composition-based stats. Identities = 45/83 (54%), Positives = 58/83 (69%) Query: 11 PGDEEDAAITAAALSDPDNPPLTAEDFAAMRPARGRGRPAGSGTKVQVTMRFDIDVLEAF 70 P DEEDAAI +DPD + AEDFA M RGRP KVQ+T+R+D+D+++AF Sbjct: 2 PTDEEDAAINRGIAADPDTFEVPAEDFAKMTRRGKRGRPPLEAPKVQLTVRYDVDIVDAF 61 Query: 71 KSEGAGWQSRMNGALREWLAQHR 93 K+ G GWQ+RMN ALREWL +H+ Sbjct: 62 KATGEGWQTRMNDALREWLKEHQ 84