BLASTP 2.2.17 [Aug-26-2007] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= 0001.1319.p (121 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 15,459,386 sequences; 5,307,515,862 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_002923759.1| hypothetical protein HDEF_0895 [Candidatus H... 131 3e-29 ref|ZP_08342925.1| hypothetical protein ECHG_01052 [Escherichia ... 125 2e-27 ref|ZP_04617672.1| hypothetical protein yruck0001_9710 [Yersinia... 124 4e-27 ref|ZP_03045946.1| conserved hypothetical protein [Escherichia c... 124 4e-27 ref|NP_670245.1| hypothetical protein y2945 [Yersinia pestis KIM... 124 6e-27 >ref|YP_002923759.1| hypothetical protein HDEF_0895 [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)] gb|ACQ67611.1| conserved hypothetical phage protein [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)] Length = 122 Score = 131 bits (330), Expect = 3e-29, Method: Composition-based stats. Identities = 73/115 (63%), Positives = 91/115 (79%) Query: 3 LLAGTSSVSVDGVTYQLEGSLKYSVSTVKRETMTGQDGVHGYKETPIAGYMAFTLRDAGG 62 LLAGT+ V+VDG+T +EGS KY + VKRET+TG DGVHGYKE P AG ++ +LRD+ G Sbjct: 7 LLAGTAYVTVDGLTVMVEGSFKYKPTRVKRETLTGMDGVHGYKEKPSAGSISMSLRDSRG 66 Query: 63 LSVSDFNKMRDALVVAQLANGKTIIGNNMWTVEQQEVDTTDAKFDVRFESNSVTE 117 SV FN + VVAQLANGKTIIG++MWTV++QEVD+ DAKFDV++E SVTE Sbjct: 67 TSVIGFNNQTNVTVVAQLANGKTIIGSHMWTVDEQEVDSEDAKFDVKWEGLSVTE 121 >ref|ZP_08342925.1| hypothetical protein ECHG_01052 [Escherichia coli H736] gb|EGI10808.1| hypothetical protein ECHG_01052 [Escherichia coli H736] Length = 123 Score = 125 bits (314), Expect = 2e-27, Method: Composition-based stats. Identities = 69/116 (59%), Positives = 86/116 (74%) Query: 2 NLLAGTSSVSVDGVTYQLEGSLKYSVSTVKRETMTGQDGVHGYKETPIAGYMAFTLRDAG 61 N LAGT+ V+V+GVT +EGS KY STV R T+TG DGVHGYKE P+A Y++ LRD+G Sbjct: 7 NRLAGTAYVTVNGVTVMVEGSFKYQTSTVNRTTLTGMDGVHGYKEKPVAPYISARLRDSG 66 Query: 62 GLSVSDFNKMRDALVVAQLANGKTIIGNNMWTVEQQEVDTTDAKFDVRFESNSVTE 117 G +V FNK + V+A+LANGKTIIG +WTV QEV++ DA FDVR+E VTE Sbjct: 67 GTNVLGFNKQTNVNVIAELANGKTIIGRALWTVNVQEVESEDAVFDVRWEGRDVTE 122 >ref|ZP_04617672.1| hypothetical protein yruck0001_9710 [Yersinia ruckeri ATCC 29473] gb|EEP97826.1| hypothetical protein yruck0001_9710 [Yersinia ruckeri ATCC 29473] Length = 122 Score = 124 bits (312), Expect = 4e-27, Method: Composition-based stats. Identities = 66/116 (56%), Positives = 88/116 (75%) Query: 2 NLLAGTSSVSVDGVTYQLEGSLKYSVSTVKRETMTGQDGVHGYKETPIAGYMAFTLRDAG 61 N LAGT+ V+VDG+T + G KYS S VKRET+TG DGVHGYKET A +++ +RD+G Sbjct: 6 NRLAGTAFVTVDGLTIMVAGQFKYSPSRVKRETLTGMDGVHGYKETFSAPFISCQIRDSG 65 Query: 62 GLSVSDFNKMRDALVVAQLANGKTIIGNNMWTVEQQEVDTTDAKFDVRFESNSVTE 117 G S+SDFN+ + ++ +LANGKTIIG+ MW+V QEVD+T+A D+R+E SVTE Sbjct: 66 GTSISDFNEQTNVSIICELANGKTIIGSGMWSVNTQEVDSTEATADIRWEGGSVTE 121 >ref|ZP_03045946.1| conserved hypothetical protein [Escherichia coli E22] gb|EDV82171.1| conserved hypothetical protein [Escherichia coli E22] Length = 123 Score = 124 bits (312), Expect = 4e-27, Method: Composition-based stats. Identities = 67/116 (57%), Positives = 87/116 (75%) Query: 2 NLLAGTSSVSVDGVTYQLEGSLKYSVSTVKRETMTGQDGVHGYKETPIAGYMAFTLRDAG 61 N LAGT+ V+V+GVT +EGS KY +TV R T+TG DGVHGYKE P+A Y++ LRD+G Sbjct: 7 NRLAGTAYVTVNGVTVMVEGSFKYQAATVNRTTLTGMDGVHGYKEKPVAPYISARLRDSG 66 Query: 62 GLSVSDFNKMRDALVVAQLANGKTIIGNNMWTVEQQEVDTTDAKFDVRFESNSVTE 117 G +V FN+ + V+A+LANGKTIIG ++WTV QEV++ DA FDVR+E VTE Sbjct: 67 GTNVQGFNQQTNVNVIAELANGKTIIGRSLWTVNVQEVESEDAVFDVRWEGRDVTE 122 >ref|NP_670245.1| hypothetical protein y2945 [Yersinia pestis KIM 10] ref|NP_992277.1| hypothetical protein YP_0898 [Yersinia pestis biovar Microtus str. 91001] ref|YP_650870.1| hypothetical protein YPA_0957 [Yersinia pestis Antiqua] ref|YP_648662.1| hypothetical protein YPN_2735 [Yersinia pestis Nepal516] ref|YP_001163799.1| hypothetical protein YPDSF_2452 [Yersinia pestis Pestoides F] ref|ZP_01888806.1| hypothetical protein YPE_2012 [Yersinia pestis CA88-4125] ref|YP_001401705.1| hypothetical protein YpsIP31758_2740 [Yersinia pseudotuberculosis IP 31758] ref|YP_001605981.1| hypothetical protein YpAngola_A1466 [Yersinia pestis Angola] ref|ZP_02220441.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis str. F1991016] ref|ZP_02224782.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis str. IP275] ref|ZP_02230784.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str. E1979001] ref|ZP_02237606.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str. B42003004] ref|ZP_02305711.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str. UG05-0454] ref|ZP_02311664.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis str. MG05-1020] ref|ZP_02315686.1| conserved hypothetical protein [Yersinia pestis biovar Mediaevalis str. K1973002] ref|YP_001721547.1| hypothetical protein YPK_2818 [Yersinia pseudotuberculosis YPIII] ref|YP_001871800.1| hypothetical protein YPTS_1368 [Yersinia pseudotuberculosis PB1/+] ref|YP_002346272.1| hypothetical protein YPO1243 [Yersinia pestis CO92] ref|ZP_04461349.1| hypothetical protein YPH_3568 [Yersinia pestis biovar Orientalis str. PEXU2] ref|ZP_04463441.1| hypothetical protein YPF_1674 [Yersinia pestis biovar Orientalis str. India 195] ref|ZP_04509277.1| hypothetical protein YPS_1858 [Yersinia pestis Pestoides A] ref|ZP_04518437.1| hypothetical protein YP516_3089 [Yersinia pestis Nepal516] ref|ZP_06204202.1| conserved hypothetical protein [Yersinia pestis KIM D27] ref|YP_003567313.1| hypothetical protein YPZ3_1141 [Yersinia pestis Z176003] gb|AAM86496.1|AE013896_4 hypothetical [Yersinia pestis KIM 10] gb|AAS61154.1| hypothetical protein YP_0898 [Yersinia pestis biovar Microtus str. 91001] gb|ABG19062.1| hypothetical protein YPN_2735 [Yersinia pestis Nepal516] gb|ABG12925.1| hypothetical protein YPA_0957 [Yersinia pestis Antiqua] emb|CAL19900.1| hypothetical protein YPO1243 [Yersinia pestis CO92] gb|ABP40826.1| hypothetical protein YPDSF_2452 [Yersinia pestis Pestoides F] gb|EDM41221.1| hypothetical protein YPE_2012 [Yersinia pestis CA88-4125] gb|ABS49408.1| conserved hypothetical protein [Yersinia pseudotuberculosis IP 31758] gb|ABX86865.1| conserved hypothetical protein [Yersinia pestis Angola] gb|EDR34435.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis str. IP275] gb|EDR40801.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis str. F1991016] gb|EDR43583.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str. E1979001] gb|EDR51822.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str. B42003004] gb|EDR58673.1| conserved hypothetical protein [Yersinia pestis biovar Orientalis str. MG05-1020] gb|EDR61555.1| conserved hypothetical protein [Yersinia pestis biovar Antiqua str. UG05-0454] gb|EDR66545.1| conserved hypothetical protein [Yersinia pestis biovar Mediaevalis str. K1973002] gb|ACA69094.1| conserved hypothetical protein [Yersinia pseudotuberculosis YPIII] gb|ACC88343.1| conserved hypothetical protein [Yersinia pseudotuberculosis PB1/+] gb|EEO75197.1| hypothetical protein YP516_3089 [Yersinia pestis Nepal516] gb|EEO81703.1| hypothetical protein YPF_1674 [Yersinia pestis biovar Orientalis str. India 195] gb|EEO87603.1| hypothetical protein YPH_3568 [Yersinia pestis biovar Orientalis str. PEXU2] gb|EEO90989.1| hypothetical protein YPS_1858 [Yersinia pestis Pestoides A] gb|ACY58011.1| hypothetical protein YPD4_1102 [Yersinia pestis D106004] gb|ACY61730.1| hypothetical protein YPD8_1045 [Yersinia pestis D182038] gb|EFA46409.1| conserved hypothetical protein [Yersinia pestis KIM D27] gb|ADE64051.1| hypothetical protein YPZ3_1141 [Yersinia pestis Z176003] gb|ADV99485.1| hypothetical protein YPC_2960 [Yersinia pestis biovar Medievalis str. Harbin 35] gb|AEL74633.1| hypothetical protein A1122_20105 [Yersinia pestis A1122] Length = 122 Score = 124 bits (310), Expect = 6e-27, Method: Composition-based stats. Identities = 68/116 (58%), Positives = 85/116 (73%) Query: 2 NLLAGTSSVSVDGVTYQLEGSLKYSVSTVKRETMTGQDGVHGYKETPIAGYMAFTLRDAG 61 N LAGT+ V+VDG+T + GS KYS S VKRET+ G DGVHGYKET A Y+ +RD+G Sbjct: 6 NRLAGTAYVTVDGITVMVAGSFKYSPSRVKRETVMGMDGVHGYKETINAPYIVCQIRDSG 65 Query: 62 GLSVSDFNKMRDALVVAQLANGKTIIGNNMWTVEQQEVDTTDAKFDVRFESNSVTE 117 G+SVSDFN +V +LANGKTIIG+ MW+V QEVD+T+ +VR+E SVTE Sbjct: 66 GISVSDFNDQTHVNIVCELANGKTIIGSAMWSVNTQEVDSTEGTLEVRWEGGSVTE 121