BLASTP Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0037.0257.p (119 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 15,459,386 sequences; 5,307,515,862 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_004752158.1| 50S ribosomal protein L20p [Collimonas fungi... 226 1e-57 ref|YP_001353180.1| 50S ribosomal protein L20 [Janthinobacterium... 223 5e-57 ref|YP_001100078.1| 50S ribosomal protein L20 [Herminiimonas ars... 220 5e-56 ref|YP_003775389.1| 50S ribosomal protein L20 [Herbaspirillum se... 218 2e-55 ref|YP_295492.1| 50S ribosomal protein L20 [Ralstonia eutropha J... 213 7e-54 >ref|YP_004752158.1| 50S ribosomal protein L20p [Collimonas fungivorans Ter331] gb|AEK61335.1| LSU ribosomal protein L20p [Collimonas fungivorans Ter331] Length = 119 Score = 226 bits (575), Expect = 1e-57, Method: Compositional matrix adjust. Identities = 112/118 (94%), Positives = 115/118 (97%) Query: 1 MPRVKRGVTARARHKKVLAQAKGYRGRRSTVYRIAKQAVMRAGQYAYRDRRNKKRVFRAL 60 MPRVKRGVTARARHKK+L QAKGYRGRRS VYR+AKQAVMRAGQYAYRDRRNKKRVFRAL Sbjct: 1 MPRVKRGVTARARHKKILVQAKGYRGRRSKVYRVAKQAVMRAGQYAYRDRRNKKRVFRAL 60 Query: 61 WIARINAAAREHGVTYSVFMNGLKRASIELDRKVLADMAVTDKPAFAAIVNQVKANIA 118 WIARINAA+REHGVTYSVFMNGLKRASIELDRKVLADMAV DKPAFAAIVNQVKANIA Sbjct: 61 WIARINAASREHGVTYSVFMNGLKRASIELDRKVLADMAVMDKPAFAAIVNQVKANIA 118 >ref|YP_001353180.1| 50S ribosomal protein L20 [Janthinobacterium sp. Marseille] sp|A6SY33.1|RL20_JANMA RecName: Full=50S ribosomal protein L20 gb|ABR89192.1| large subunit ribosomal protein L20 [Janthinobacterium sp. Marseille] Length = 119 Score = 223 bits (569), Expect = 5e-57, Method: Compositional matrix adjust. Identities = 112/118 (94%), Positives = 114/118 (96%) Query: 1 MPRVKRGVTARARHKKVLAQAKGYRGRRSTVYRIAKQAVMRAGQYAYRDRRNKKRVFRAL 60 MPRVKRGVTARARHKKVL QAKGYRGRRS VYRIAKQAVMRAGQYAYRDRRNKKRVFRAL Sbjct: 1 MPRVKRGVTARARHKKVLDQAKGYRGRRSKVYRIAKQAVMRAGQYAYRDRRNKKRVFRAL 60 Query: 61 WIARINAAAREHGVTYSVFMNGLKRASIELDRKVLADMAVTDKPAFAAIVNQVKANIA 118 WI RINAA+REHG+TYSVFMNGLKRASIELDRKVLADMAV DKPAFAAIVNQVKANIA Sbjct: 61 WITRINAASREHGLTYSVFMNGLKRASIELDRKVLADMAVMDKPAFAAIVNQVKANIA 118 >ref|YP_001100078.1| 50S ribosomal protein L20 [Herminiimonas arsenicoxydans] sp|A4G616.1|RL20_HERAR RecName: Full=50S ribosomal protein L20 emb|CAL61953.1| 50S ribosomal subunit protein L20 [Herminiimonas arsenicoxydans] Length = 119 Score = 220 bits (561), Expect = 5e-56, Method: Compositional matrix adjust. Identities = 110/118 (93%), Positives = 112/118 (94%) Query: 1 MPRVKRGVTARARHKKVLAQAKGYRGRRSTVYRIAKQAVMRAGQYAYRDRRNKKRVFRAL 60 MPRVKRGVTARARHKKVL QAKGYRGRRS VYRIAKQAVMRAGQYAYRDRRNKKRVFRAL Sbjct: 1 MPRVKRGVTARARHKKVLDQAKGYRGRRSKVYRIAKQAVMRAGQYAYRDRRNKKRVFRAL 60 Query: 61 WIARINAAAREHGVTYSVFMNGLKRASIELDRKVLADMAVTDKPAFAAIVNQVKANIA 118 WI RINAA+REHG+TYSVFMNGLKRASIELDRKVLADMAV DKPAFAAIVNQVK IA Sbjct: 61 WITRINAASREHGLTYSVFMNGLKRASIELDRKVLADMAVMDKPAFAAIVNQVKTTIA 118 >ref|YP_003775389.1| 50S ribosomal protein L20 [Herbaspirillum seropedicae SmR1] gb|ADJ63481.1| 50S ribosomal subunit L20 protein [Herbaspirillum seropedicae SmR1] Length = 120 Score = 218 bits (556), Expect = 2e-55, Method: Compositional matrix adjust. Identities = 111/118 (94%), Positives = 113/118 (95%) Query: 1 MPRVKRGVTARARHKKVLAQAKGYRGRRSTVYRIAKQAVMRAGQYAYRDRRNKKRVFRAL 60 MPRVKRGVTARARHKKVLA AKGYRGRR VYRIAKQAVMRAGQYAYRDRRNKKRVFRAL Sbjct: 1 MPRVKRGVTARARHKKVLALAKGYRGRRKNVYRIAKQAVMRAGQYAYRDRRNKKRVFRAL 60 Query: 61 WIARINAAAREHGVTYSVFMNGLKRASIELDRKVLADMAVTDKPAFAAIVNQVKANIA 118 WIARINAAAR HGVTYSVFMNGLK+A+IELDRKVLADMAVTDK AFAAIVNQVKANIA Sbjct: 61 WIARINAAARSHGVTYSVFMNGLKKAAIELDRKVLADMAVTDKAAFAAIVNQVKANIA 118 >ref|YP_295492.1| 50S ribosomal protein L20 [Ralstonia eutropha JMP134] ref|YP_583318.1| 50S ribosomal protein L20 [Cupriavidus metallidurans CH34] ref|YP_725849.1| 50S ribosomal protein L20 [Ralstonia eutropha H16] ref|YP_002005293.1| 50S ribosomal protein l20 [Cupriavidus taiwanensis LMG 19424] ref|YP_004685164.1| 50S ribosomal protein L20 [Cupriavidus necator N-1] sp|Q472N5.1|RL20_RALEJ RecName: Full=50S ribosomal protein L20 sp|Q0KBZ0.1|RL20_RALEH RecName: Full=50S ribosomal protein L20 sp|Q1LP77.1|RL20_RALME RecName: Full=50S ribosomal protein L20 sp|B3R4J4.1|RL20_CUPTR RecName: Full=50S ribosomal protein L20 gb|AAZ60648.1| LSU ribosomal protein L20P [Ralstonia eutropha JMP134] gb|ABF08049.1| 50S ribosomal subunit protein L20 [Cupriavidus metallidurans CH34] emb|CAJ92481.1| LSU ribosomal protein L20 [Ralstonia eutropha H16] emb|CAQ69226.1| 50S ribosomal subunit protein L20, also posttranslational autoregulator [Cupriavidus taiwanensis LMG 19424] gb|AEI76683.1| 50S ribosomal protein L20 [Cupriavidus necator N-1] Length = 118 Score = 213 bits (542), Expect = 7e-54, Method: Compositional matrix adjust. Identities = 105/118 (88%), Positives = 112/118 (94%) Query: 1 MPRVKRGVTARARHKKVLAQAKGYRGRRSTVYRIAKQAVMRAGQYAYRDRRNKKRVFRAL 60 MPRVKRGVTARARHKKV+ AKGYRGRR+ VYRIAKQAVMRAGQYAYRDRRNKKRVFRAL Sbjct: 1 MPRVKRGVTARARHKKVIDAAKGYRGRRNNVYRIAKQAVMRAGQYAYRDRRNKKRVFRAL 60 Query: 61 WIARINAAAREHGVTYSVFMNGLKRASIELDRKVLADMAVTDKPAFAAIVNQVKANIA 118 WIARINAA REHG+TYSVFMNGLK+ASIELDRKVL+DMA+ DKPAFAAIVNQVKA +A Sbjct: 61 WIARINAATREHGMTYSVFMNGLKKASIELDRKVLSDMAIHDKPAFAAIVNQVKATVA 118 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Oct 2, 2011 4:36 PM Number of letters in database: 5,307,515,862 Number of sequences in database: 15,459,386 Lambda K H 0.323 0.140 0.448 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 15459386 Number of Hits to DB: 13,012,725,510,140 Number of extensions: -1678729089 Number of successful extensions: 1585346382 Number of sequences better than 1.0e-08: 22254106 Number of HSP's gapped: 1548208849 Number of HSP's successfully gapped: 30063395 Length of database: 5,307,515,862 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 153 (63.5 bits)