BLASTP 2.2.21 [Jun-14-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0009.0306.p (192 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 15,459,386 sequences; 5,307,515,862 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_003775184.1| hypothetical protein Hsero_1763 [Herbaspiril... 308 2e-82 ref|YP_106887.1| hypothetical protein BPSL0260 [Burkholderia pse... 282 1e-74 ref|YP_331864.1| hypothetical protein BURPS1710b_0450 [Burkholde... 281 3e-74 ref|ZP_02361272.1| hypothetical protein BoklC_01059 [Burkholderi... 281 3e-74 ref|ZP_02461975.1| hypothetical protein Bpse38_01294 [Burkholder... 281 4e-74 >ref|YP_003775184.1| hypothetical protein Hsero_1763 [Herbaspirillum seropedicae SmR1] gb|ADJ63276.1| conserved hypothetical protein [Herbaspirillum seropedicae SmR1] Length = 170 Score = 308 bits (790), Expect = 2e-82, Method: Compositional matrix adjust. Identities = 147/162 (90%), Positives = 154/162 (95%) Query: 19 PTKIVSSNHLVSERSAELSELEYALIMAGNAFNRWMMRCMMAAGAKDMTAIEVSLLHHVN 78 PTKIVSS HLVSERSAELSELEYALIMA NAFNRWM+RCM AAGAKDMTAIEVSLLHHVN Sbjct: 5 PTKIVSSQHLVSERSAELSELEYALIMASNAFNRWMVRCMAAAGAKDMTAIEVSLLHHVN 64 Query: 79 HRERKKKLADICFVLNIEDTHVVTYALKKLVKAGYVKSEKAGKELLFSTTDEGQQLCMRY 138 HR+RKKKLADICFVLN+EDTHVVTYALKKLVKAGYVKSEKAGKELLFSTT GQ LCM+Y Sbjct: 65 HRDRKKKLADICFVLNVEDTHVVTYALKKLVKAGYVKSEKAGKELLFSTTPAGQALCMKY 124 Query: 139 KEVRERCLIEVQVDSGIQNQAIGEAAQLLRSASGLYDTAARA 180 +EVRERCLIEVQ +SGI NQAIGEAAQLLR+ASGLYDTAARA Sbjct: 125 REVRERCLIEVQAESGIPNQAIGEAAQLLRNASGLYDTAARA 166 >ref|YP_106887.1| hypothetical protein BPSL0260 [Burkholderia pseudomallei K96243] ref|YP_104782.1| hypothetical protein BMA3312 [Burkholderia mallei ATCC 23344] ref|ZP_00440303.1| transcriptional regulator, MarR family [Burkholderia mallei GB8 horse 4] ref|YP_994276.1| hypothetical protein BMASAVP1_A2982 [Burkholderia mallei SAVP1] ref|YP_001028074.1| hypothetical protein BMA10229_A2110 [Burkholderia mallei NCTC 10229] ref|YP_001057308.1| hypothetical protein BURPS668_0255 [Burkholderia pseudomallei 668] ref|YP_001082882.1| hypothetical protein BMA10247_3366 [Burkholderia mallei NCTC 10247] ref|YP_001064550.1| hypothetical protein BURPS1106A_0267 [Burkholderia pseudomallei 1106a] ref|ZP_02267313.1| transcriptional regulator, MarR family [Burkholderia mallei PRL-20] ref|ZP_02400878.1| hypothetical protein BpseD_01406 [Burkholderia pseudomallei DM98] ref|ZP_02409457.1| hypothetical protein Bpse14_01394 [Burkholderia pseudomallei 14] ref|ZP_02445462.1| hypothetical protein Bpse9_01506 [Burkholderia pseudomallei 91] ref|ZP_02453772.1| hypothetical protein Bpseu9_01404 [Burkholderia pseudomallei 9] ref|ZP_02479794.1| hypothetical protein Bpse7_01429 [Burkholderia pseudomallei 7894] ref|ZP_02504238.1| hypothetical protein BpseBC_01269 [Burkholderia pseudomallei BCC215] ref|ZP_03456385.1| transcriptional regulator, MarR family [Burkholderia pseudomallei 576] ref|ZP_03795345.1| transcriptional regulator, MarR family [Burkholderia pseudomallei Pakistan 9] ref|ZP_04813816.1| transcriptional regulator, MarR family [Burkholderia pseudomallei 1106b] ref|ZP_04881379.1| conserved hypothetical protein [Burkholderia mallei ATCC 10399] ref|ZP_04888749.1| conserved hypothetical protein [Burkholderia pseudomallei 1655] ref|ZP_04908248.1| transcriptional regulator, MarR family [Burkholderia mallei FMH] ref|ZP_04913568.1| transcriptional regulator, MarR family [Burkholderia mallei JHU] ref|ZP_04975991.1| transcriptional regulator, MarR family [Burkholderia mallei 2002721280] emb|CAH34248.1| conserved hypothetical protein [Burkholderia pseudomallei K96243] gb|AAU48566.1| conserved hypothetical protein [Burkholderia mallei ATCC 23344] gb|ABM52458.1| conserved hypothetical protein [Burkholderia mallei SAVP1] gb|ABN02761.1| conserved hypothetical protein [Burkholderia mallei NCTC 10229] gb|ABN85248.1| conserved hypothetical protein [Burkholderia pseudomallei 668] gb|ABN91936.1| transcriptional regulator, MarR family [Burkholderia pseudomallei 1106a] gb|ABO04471.1| conserved hypothetical protein [Burkholderia mallei NCTC 10247] gb|EDK54854.1| transcriptional regulator, MarR family [Burkholderia mallei FMH] gb|EDK59825.1| transcriptional regulator, MarR family [Burkholderia mallei JHU] gb|EDK86866.1| transcriptional regulator, MarR family [Burkholderia mallei 2002721280] gb|EDP85733.1| conserved hypothetical protein [Burkholderia mallei ATCC 10399] gb|EDU09733.1| conserved hypothetical protein [Burkholderia pseudomallei 1655] gb|EEC31935.1| transcriptional regulator, MarR family [Burkholderia pseudomallei 576] gb|EEH24181.1| transcriptional regulator, MarR family [Burkholderia pseudomallei Pakistan 9] gb|EEP85918.1| transcriptional regulator, MarR family [Burkholderia mallei GB8 horse 4] gb|EES24441.1| transcriptional regulator, MarR family [Burkholderia pseudomallei 1106b] gb|EES44909.1| transcriptional regulator, MarR family [Burkholderia mallei PRL-20] Length = 170 Score = 282 bits (722), Expect = 1e-74, Method: Compositional matrix adjust. Identities = 133/165 (80%), Positives = 146/165 (88%) Query: 16 QKSPTKIVSSNHLVSERSAELSELEYALIMAGNAFNRWMMRCMMAAGAKDMTAIEVSLLH 75 Q+ PTKIVSS HLVSE SAELSELEYALIMAGNAFNRWM+RCM AAGAKDMTA+EVSLLH Sbjct: 2 QRHPTKIVSSEHLVSETSAELSELEYALIMAGNAFNRWMVRCMAAAGAKDMTAVEVSLLH 61 Query: 76 HVNHRERKKKLADICFVLNIEDTHVVTYALKKLVKAGYVKSEKAGKELLFSTTDEGQQLC 135 HV+HR+RKKKLADICFVLNIEDTHV TYALKKLV GYVKSEK GKE+ F TD G+ LC Sbjct: 62 HVSHRDRKKKLADICFVLNIEDTHVATYALKKLVARGYVKSEKTGKEVFFDATDAGRALC 121 Query: 136 MRYKEVRERCLIEVQVDSGIQNQAIGEAAQLLRSASGLYDTAARA 180 +RY++VRERCLIE DSG+ N+ IG+AAQLLR ASGLYDTAARA Sbjct: 122 LRYRDVRERCLIETLKDSGLTNEQIGDAAQLLRHASGLYDTAARA 166 >ref|YP_331864.1| hypothetical protein BURPS1710b_0450 [Burkholderia pseudomallei 1710b] ref|ZP_01770374.1| transcriptional regulator, MarR family [Burkholderia pseudomallei 305] ref|ZP_02469398.1| hypothetical protein BpseB_01272 [Burkholderia pseudomallei B7210] ref|ZP_02488093.1| hypothetical protein BpseN_01339 [Burkholderia pseudomallei NCTC 13177] ref|ZP_02496198.1| hypothetical protein Bpse112_01332 [Burkholderia pseudomallei 112] ref|YP_002894897.1| transcriptional regulator [Burkholderia pseudomallei MSHR346] ref|ZP_04894594.1| conserved hypothetical protein [Burkholderia pseudomallei Pasteur 52237] ref|ZP_04902988.1| conserved hypothetical protein [Burkholderia pseudomallei S13] ref|ZP_04950097.1| conserved hypothetical protein [Burkholderia pseudomallei 1710a] ref|ZP_04963258.1| conserved hypothetical protein [Burkholderia pseudomallei 406e] gb|ABA49420.1| conserved hypothetical protein [Burkholderia pseudomallei 1710b] gb|EBA45179.1| transcriptional regulator, MarR family [Burkholderia pseudomallei 305] gb|EDO82921.1| conserved hypothetical protein [Burkholderia pseudomallei 406e] gb|EDO91432.1| conserved hypothetical protein [Burkholderia pseudomallei Pasteur 52237] gb|EDS86000.1| conserved hypothetical protein [Burkholderia pseudomallei S13] gb|ACQ96889.1| transcriptional regulator [Burkholderia pseudomallei MSHR346] gb|EET07116.1| conserved hypothetical protein [Burkholderia pseudomallei 1710a] Length = 170 Score = 281 bits (720), Expect = 3e-74, Method: Compositional matrix adjust. Identities = 132/165 (80%), Positives = 146/165 (88%) Query: 16 QKSPTKIVSSNHLVSERSAELSELEYALIMAGNAFNRWMMRCMMAAGAKDMTAIEVSLLH 75 Q+ PTKIVSS HLVSE SAELSELEYALIMAGNAFNRWM+RCM AAGAKDMTA+EVSLLH Sbjct: 2 QRHPTKIVSSEHLVSETSAELSELEYALIMAGNAFNRWMVRCMAAAGAKDMTAVEVSLLH 61 Query: 76 HVNHRERKKKLADICFVLNIEDTHVVTYALKKLVKAGYVKSEKAGKELLFSTTDEGQQLC 135 HV+HR+RKKKLADICFVLNIEDTHV TYAL+KLV GYVKSEK GKE+ F TD G+ LC Sbjct: 62 HVSHRDRKKKLADICFVLNIEDTHVATYALRKLVARGYVKSEKTGKEVFFDATDAGRALC 121 Query: 136 MRYKEVRERCLIEVQVDSGIQNQAIGEAAQLLRSASGLYDTAARA 180 +RY++VRERCLIE DSG+ N+ IG+AAQLLR ASGLYDTAARA Sbjct: 122 LRYRDVRERCLIETLKDSGLTNEQIGDAAQLLRHASGLYDTAARA 166 >ref|ZP_02361272.1| hypothetical protein BoklC_01059 [Burkholderia oklahomensis C6786] Length = 170 Score = 281 bits (719), Expect = 3e-74, Method: Compositional matrix adjust. Identities = 132/165 (80%), Positives = 146/165 (88%) Query: 16 QKSPTKIVSSNHLVSERSAELSELEYALIMAGNAFNRWMMRCMMAAGAKDMTAIEVSLLH 75 Q+ PTKIVSS HLVSE SAELSELEYALIMAGNAFNRWM+RCM AAGAKDMTA+EVSLLH Sbjct: 2 QRHPTKIVSSEHLVSETSAELSELEYALIMAGNAFNRWMVRCMAAAGAKDMTAVEVSLLH 61 Query: 76 HVNHRERKKKLADICFVLNIEDTHVVTYALKKLVKAGYVKSEKAGKELLFSTTDEGQQLC 135 HV+HR+RKKKLADICFVLNIEDTHV TYALKKLV GYVKSEK GKE+ F TD G+ LC Sbjct: 62 HVSHRDRKKKLADICFVLNIEDTHVATYALKKLVARGYVKSEKTGKEVFFDATDAGRALC 121 Query: 136 MRYKEVRERCLIEVQVDSGIQNQAIGEAAQLLRSASGLYDTAARA 180 ++Y++VRERCLIE DSG+ N+ IG+AAQLLR ASGLYDTAARA Sbjct: 122 LKYRDVRERCLIETLKDSGLTNEQIGDAAQLLRHASGLYDTAARA 166 >ref|ZP_02461975.1| hypothetical protein Bpse38_01294 [Burkholderia thailandensis MSMB43] Length = 170 Score = 281 bits (719), Expect = 4e-74, Method: Compositional matrix adjust. Identities = 132/165 (80%), Positives = 146/165 (88%) Query: 16 QKSPTKIVSSNHLVSERSAELSELEYALIMAGNAFNRWMMRCMMAAGAKDMTAIEVSLLH 75 Q+ PTKIVSS HLVSE SAELSELEYALIMAGNAFNRWM+RCM AAGAKDMTA+EVSLLH Sbjct: 2 QRHPTKIVSSEHLVSETSAELSELEYALIMAGNAFNRWMVRCMAAAGAKDMTAVEVSLLH 61 Query: 76 HVNHRERKKKLADICFVLNIEDTHVVTYALKKLVKAGYVKSEKAGKELLFSTTDEGQQLC 135 HV+HR+RKKKLADICFVLNIEDTHV TYALKKLV GYVKSEK GKE+ F TD G+ LC Sbjct: 62 HVSHRDRKKKLADICFVLNIEDTHVATYALKKLVARGYVKSEKTGKEVFFEATDAGRALC 121 Query: 136 MRYKEVRERCLIEVQVDSGIQNQAIGEAAQLLRSASGLYDTAARA 180 ++Y++VRERCLIE DSG+ N+ IG+AAQLLR ASGLYDTAARA Sbjct: 122 LKYRDVRERCLIETLKDSGLTNEQIGDAAQLLRHASGLYDTAARA 166