BLASTP 2.2.21 [Jun-14-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0009.0277.p (59 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 15,459,386 sequences; 5,307,515,862 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_003773477.1| acyl-CoA transferase [Herbaspirillum seroped... 91 4e-17 ref|YP_001370691.1| Acetyl-CoA hydrolase [Ochrobactrum anthropi ... 91 5e-17 ref|YP_605918.1| acetyl-CoA hydrolase/transferase [Pseudomonas e... 90 1e-16 ref|ZP_08140130.1| acetyl-CoA hydrolase [Pseudomonas sp. TJI-51]... 89 2e-16 ref|NP_539845.1| acetate CoA-transferase alpha subunit [Brucella... 89 2e-16 >ref|YP_003773477.1| acyl-CoA transferase [Herbaspirillum seropedicae SmR1] gb|ADJ61569.1| acyl-CoA transferase protein [Herbaspirillum seropedicae SmR1] Length = 500 Score = 91.3 bits (225), Expect = 4e-17, Method: Composition-based stats. Identities = 38/56 (67%), Positives = 43/56 (76%) Query: 2 PRERAPLIIDHCAHPDYRPALRDYFTRACRAGGHTPHLLVEALSWHECYKNDKTMR 57 PRERA +I+ C HPDYR LRDYF RAC+AGGHTPHLL EA SWH+ Y +TMR Sbjct: 439 PRERAVKVIEQCCHPDYRAQLRDYFERACQAGGHTPHLLGEAFSWHQHYARHRTMR 494 >ref|YP_001370691.1| Acetyl-CoA hydrolase [Ochrobactrum anthropi ATCC 49188] gb|ABS14862.1| Acetyl-CoA hydrolase [Ochrobactrum anthropi ATCC 49188] Length = 504 Score = 90.9 bits (224), Expect = 5e-17, Method: Composition-based stats. Identities = 37/56 (66%), Positives = 43/56 (76%) Query: 2 PRERAPLIIDHCAHPDYRPALRDYFTRACRAGGHTPHLLVEALSWHECYKNDKTMR 57 PRERA +IID+CAHPDYRP L DYF RAC GGHTPHL+ EA SWH+ + +MR Sbjct: 448 PRERARVIIDNCAHPDYRPQLNDYFDRACARGGHTPHLIEEAFSWHQRRRETGSMR 503 >ref|YP_605918.1| acetyl-CoA hydrolase/transferase [Pseudomonas entomophila L48] emb|CAK13101.1| putative acetyl-CoA hydrolase/transferase [Pseudomonas entomophila L48] Length = 497 Score = 90.1 bits (222), Expect = 1e-16, Method: Composition-based stats. Identities = 36/47 (76%), Positives = 40/47 (85%) Query: 2 PRERAPLIIDHCAHPDYRPALRDYFTRACRAGGHTPHLLVEALSWHE 48 PRERA +IID+C HPDYR AL DYF RAC+ GGHTPH+L EALSWHE Sbjct: 440 PRERARVIIDNCVHPDYRAALNDYFERACQRGGHTPHILREALSWHE 486 >ref|ZP_08140130.1| acetyl-CoA hydrolase [Pseudomonas sp. TJI-51] gb|EGB98588.1| acetyl-CoA hydrolase [Pseudomonas sp. TJI-51] Length = 497 Score = 89.4 bits (220), Expect = 2e-16, Method: Composition-based stats. Identities = 36/47 (76%), Positives = 40/47 (85%) Query: 2 PRERAPLIIDHCAHPDYRPALRDYFTRACRAGGHTPHLLVEALSWHE 48 PRERA +IID+C HPDYR AL DYF RAC+ GGHTPH+L EALSWHE Sbjct: 440 PRERARVIIDNCVHPDYRAALNDYFERACQRGGHTPHILREALSWHE 486 >ref|NP_539845.1| acetate CoA-transferase alpha subunit [Brucella melitensis bv. 1 str. 16M] ref|NP_698063.1| acetyl-CoA hydrolase/transferase family protein [Brucella suis 1330] ref|YP_221771.1| acetyl-CoA hydrolase/transferase family protein [Brucella abortus bv. 1 str. 9-941] ref|YP_414480.1| Acetyl-CoA hydrolase/transferase [Brucella melitensis biovar Abortus 2308] ref|YP_001258992.1| acetyl-CoA hydrolase/transferase family protein [Brucella ovis ATCC 25840] ref|YP_001592895.1| Acetyl-CoA hydrolase [Brucella canis ATCC 23365] ref|YP_001627729.1| Acetyl-CoA hydrolase [Brucella suis ATCC 23445] ref|YP_001934988.1| Acetyl-CoA hydrolase/transferase [Brucella abortus S19] ref|ZP_03785570.1| Acetyl-CoA hydrolase [Brucella ceti str. Cudo] ref|YP_002732794.1| succinate CoA transferase [Brucella melitensis ATCC 23457] ref|ZP_04594479.1| succinate CoA transferase [Brucella abortus str. 2308 A] ref|ZP_05466480.1| acetyl-CoA hydrolase/transferase [Brucella melitensis bv. 2 str. 63/9] ref|ZP_05821016.1| acetyl-CoA hydrolase/transferase [Brucella abortus NCTC 8038] ref|ZP_05834546.1| acetyl-CoA hydrolase/transferase [Brucella melitensis bv. 1 str. 16M] ref|ZP_05836875.1| acetyl-CoA hydrolase/transferase [Brucella suis bv. 4 str. 40] ref|ZP_05867143.1| acetyl-CoA hydrolase [Brucella abortus bv. 6 str. 870] ref|ZP_05870365.1| acetyl-CoA hydrolase [Brucella abortus bv. 4 str. 292] ref|ZP_05874183.1| acetyl-CoA hydrolase [Brucella abortus bv. 2 str. 86/8/59] ref|ZP_05895426.1| acetyl-CoA hydrolase [Brucella abortus bv. 9 str. C68] ref|ZP_05928327.1| acetyl-CoA hydrolase [Brucella abortus bv. 3 str. Tulya] ref|ZP_05936507.1| acetyl-CoA hydrolase [Brucella ceti B1/94] ref|ZP_05953413.1| acetyl-CoA hydrolase [Brucella pinnipedialis M163/99/10] ref|ZP_05956890.1| acetyl-CoA hydrolase [Brucella pinnipedialis B2/94] ref|ZP_05964347.1| acetyl-CoA hydrolase [Brucella neotomae 5K33] ref|ZP_05996071.1| acetyl-CoA hydrolase [Brucella suis bv. 5 str. 513] ref|ZP_06001954.1| acetyl-CoA hydrolase/transferase [Brucella sp. F5/99] ref|ZP_06101283.1| acetyl-CoA hydrolase [Brucella pinnipedialis M292/94/1] ref|ZP_06103697.1| acetyl-CoA hydrolase [Brucella melitensis bv. 1 str. Rev.1] ref|ZP_06107533.1| acetyl-CoA hydrolase [Brucella melitensis bv. 3 str. Ether] ref|ZP_06110748.1| acetyl-CoA hydrolase [Brucella ceti M490/95/1] ref|ZP_06793028.1| acetyl-CoA hydrolase [Brucella sp. NVSL 07-0026] ref|ZP_06932096.1| acetyl-CoA hydrolase [Brucella abortus bv. 5 str. B3196] ref|YP_004756142.1| acetyl-CoA hydrolase [Brucella pinnipedialis B2/94] gb|AAL52109.1| acetate CoA-transferase alpha subunit [Brucella melitensis bv. 1 str. 16M] gb|AAN29978.1| acetyl-CoA hydrolase/transferase family protein [Brucella suis 1330] gb|AAX74410.1| acetyl-CoA hydrolase/transferase family protein [Brucella abortus bv. 1 str. 9-941] emb|CAJ11033.1| Acetyl-CoA hydrolase/transferase [Brucella melitensis biovar Abortus 2308] gb|ABQ61983.1| acetyl-CoA hydrolase/transferase family protein [Brucella ovis ATCC 25840] gb|ABX62124.1| Acetyl-CoA hydrolase [Brucella canis ATCC 23365] gb|ABY38159.1| Acetyl-CoA hydrolase [Brucella suis ATCC 23445] gb|ACD72514.1| Acetyl-CoA hydrolase/transferase [Brucella abortus S19] gb|EEH14583.1| Acetyl-CoA hydrolase [Brucella ceti str. Cudo] gb|ACO00840.1| succinate CoA transferase [Brucella melitensis ATCC 23457] gb|EEP64528.1| succinate CoA transferase [Brucella abortus str. 2308 A] gb|EEW80557.1| acetyl-CoA hydrolase/transferase [Brucella abortus NCTC 8038] gb|EEW89168.1| acetyl-CoA hydrolase/transferase [Brucella melitensis bv. 1 str. 16M] gb|EEW91003.1| acetyl-CoA hydrolase/transferase [Brucella suis bv. 4 str. 40] gb|EEX55275.1| acetyl-CoA hydrolase [Brucella abortus bv. 4 str. 292] gb|EEX59093.1| acetyl-CoA hydrolase [Brucella abortus bv. 2 str. 86/8/59] gb|EEX61724.1| acetyl-CoA hydrolase [Brucella abortus bv. 6 str. 870] gb|EEX80409.1| acetyl-CoA hydrolase [Brucella abortus bv. 9 str. C68] gb|EEX82514.1| acetyl-CoA hydrolase [Brucella abortus bv. 3 str. Tulya] gb|EEX87463.1| acetyl-CoA hydrolase [Brucella ceti B1/94] gb|EEY00413.1| acetyl-CoA hydrolase [Brucella pinnipedialis B2/94] gb|EEY04627.1| acetyl-CoA hydrolase [Brucella neotomae 5K33] gb|EEY06739.1| acetyl-CoA hydrolase [Brucella pinnipedialis M163/99/10] gb|EEY26225.1| acetyl-CoA hydrolase/transferase [Brucella sp. F5/99] gb|EEY30041.1| acetyl-CoA hydrolase [Brucella suis bv. 5 str. 513] gb|EEZ08649.1| acetyl-CoA hydrolase [Brucella ceti M490/95/1] gb|EEZ11878.1| acetyl-CoA hydrolase [Brucella melitensis bv. 3 str. Ether] gb|EEZ14499.1| acetyl-CoA hydrolase [Brucella melitensis bv. 1 str. Rev.1] gb|EEZ18014.1| acetyl-CoA hydrolase/transferase [Brucella melitensis bv. 2 str. 63/9] gb|EEZ31184.1| acetyl-CoA hydrolase [Brucella pinnipedialis M292/94/1] gb|EFG37943.1| acetyl-CoA hydrolase [Brucella sp. NVSL 07-0026] gb|EFH34894.1| acetyl-CoA hydrolase [Brucella abortus bv. 5 str. B3196] gb|ADZ66144.1| Acetyl-CoA hydrolase/transferase [Brucella melitensis M28] gb|ADZ87000.1| succinate CoA transferase [Brucella melitensis M5-90] gb|AEK54374.1| acetyl-CoA hydrolase [Brucella pinnipedialis B2/94] gb|AEM18396.1| acetyl-CoA hydrolase/transferase family protein [Brucella suis 1330] Length = 496 Score = 89.4 bits (220), Expect = 2e-16, Method: Composition-based stats. Identities = 36/57 (63%), Positives = 45/57 (78%) Query: 2 PRERAPLIIDHCAHPDYRPALRDYFTRACRAGGHTPHLLVEALSWHECYKNDKTMRQ 58 PRERAP+II++CAHPDYR L DY+ RAC+ GGHTPHLL EA SWH + + +MR+ Sbjct: 440 PRERAPVIIENCAHPDYRDQLMDYYERACKRGGHTPHLLEEAFSWHLRRQENGSMRK 496