BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0037.0091.p (124 letters) Database: BlastDatabases/689/689 4735 sequences; 1,619,870 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|300310895|ref|YP_003774987.1| dipeptide/oligopeptide/nickel A... 171 2e-44 gi|300312478|ref|YP_003776570.1| dipeptide/oligopeptide/nickel A... 80 4e-17 gi|300311168|ref|YP_003775260.1| ABC transporter ATPase [Herbasp... 74 5e-15 gi|300312716|ref|YP_003776808.1| ABC transporter duplicated ATPa... 69 1e-13 gi|300312477|ref|YP_003776569.1| oligopeptide ABC transporter AT... 63 6e-12 >gi|300310895|ref|YP_003774987.1| dipeptide/oligopeptide/nickel ABC transporter ATPase [Herbaspirillum seropedicae SmR1] Length = 330 Score = 171 bits (432), Expect = 2e-44, Method: Compositional matrix adjust. Identities = 81/97 (83%), Positives = 91/97 (93%) Query: 12 TLEVRNLRTHFYMPSGVLPAVDDVSLTLERGRILGLVGESGSGKTVTGFSILGLLDAPGR 71 TLEVRNLRTHF+ P GVLPAVDDVSL++ RGRILGLVGESGSGK+VTGFSILG++DAPGR Sbjct: 5 TLEVRNLRTHFFTPEGVLPAVDDVSLSVGRGRILGLVGESGSGKSVTGFSILGMVDAPGR 64 Query: 72 IVGGQILFKGQDLVTLDKKSLRSLQGNRIAMIFQDPM 108 IVGG+ILF+G+DLV +DK SLR LQGNRIAMIFQDPM Sbjct: 65 IVGGEILFQGRDLVRMDKTSLRELQGNRIAMIFQDPM 101 >gi|300312478|ref|YP_003776570.1| dipeptide/oligopeptide/nickel ABC transporter ATPase [Herbaspirillum seropedicae SmR1] Length = 334 Score = 80.1 bits (196), Expect = 4e-17, Method: Compositional matrix adjust. Identities = 41/96 (42%), Positives = 59/96 (61%) Query: 13 LEVRNLRTHFYMPSGVLPAVDDVSLTLERGRILGLVGESGSGKTVTGFSILGLLDAPGRI 72 L+V+NL+ +G+L AV + + RG +L LVGESG GK++T +++GLL + Sbjct: 5 LDVKNLKVDLPTENGMLHAVRGIDFQVRRGEMLCLVGESGCGKSMTSLALMGLLPRKAQC 64 Query: 73 VGGQILFKGQDLVTLDKKSLRSLQGNRIAMIFQDPM 108 ILF G DL + K L L+G R+AMIFQ+PM Sbjct: 65 SADHILFDGVDLHGMPDKQLMQLRGKRMAMIFQEPM 100 >gi|300311168|ref|YP_003775260.1| ABC transporter ATPase [Herbaspirillum seropedicae SmR1] Length = 617 Score = 73.6 bits (179), Expect = 5e-15, Method: Compositional matrix adjust. Identities = 47/110 (42%), Positives = 63/110 (57%), Gaps = 12/110 (10%) Query: 6 ATHSVPTLEVRNLRTHFYMPSGV-------LPAVDDVSLTLERGRILGLVGESGSGKTVT 58 A P L+VR+L T F + SG+ + AV+ VS L G L +VGESG GK+ T Sbjct: 306 AAQRQPILKVRDLTTRFDVKSGIFGRVRQRVHAVEKVSFDLYAGETLAIVGESGCGKSTT 365 Query: 59 GFSILGLLDAPGRIVGGQILFKGQDLVTLDKKSLRSLQGNRIAMIFQDPM 108 G S+L L+D I GG++ F G+DL L + LR L+ + I IFQDP Sbjct: 366 GRSLLRLVD----IAGGKVEFGGRDLAQLPRSELRQLRRD-IQFIFQDPF 410 Score = 70.9 bits (172), Expect = 3e-14, Method: Compositional matrix adjust. Identities = 41/103 (39%), Positives = 62/103 (60%), Gaps = 6/103 (5%) Query: 12 TLEVRNLRTHFYMPSGVLPAVDDVSLTLERGRILGLVGESGSGKTVTGFSILGLLD-APG 70 L+V +L F + AV D+S +++G L +VGESGSGK+V+ +I+ L++ G Sbjct: 7 VLDVNHLSVRFSTSERTVDAVRDLSFHVDQGETLAIVGESGSGKSVSSLAIMRLIEHGGG 66 Query: 71 RIVGGQILF---KGQ--DLVTLDKKSLRSLQGNRIAMIFQDPM 108 +I G + F GQ DL D ++RS++G IAMIFQ+PM Sbjct: 67 KIASGSMQFLRRSGQRLDLAQADNATMRSIRGAEIAMIFQEPM 109 >gi|300312716|ref|YP_003776808.1| ABC transporter duplicated ATPase [Herbaspirillum seropedicae SmR1] Length = 529 Score = 68.9 bits (167), Expect = 1e-13, Method: Compositional matrix adjust. Identities = 41/100 (41%), Positives = 57/100 (57%), Gaps = 6/100 (6%) Query: 9 SVPTLEVRNLRTHFYMPSGVLPAVDDVSLTLERGRILGLVGESGSGKTVTGFSILGLLDA 68 S LEV NL F G VD VS + G LVGESGSGKTV+ +++ L + Sbjct: 2 SAALLEVNNLTVRF----GDTVVVDRVSFAIAPGEKFALVGESGSGKTVSSLAVMQL-NQ 56 Query: 69 PGRIVGGQILFKGQDLVTLDKKSLRSLQGNRIAMIFQDPM 108 R G IL GQD++ ++ ++ ++GN +AMIFQ+PM Sbjct: 57 DARYEGS-ILLDGQDVLAKSERQMQQVRGNDVAMIFQEPM 95 Score = 59.7 bits (143), Expect = 7e-11, Method: Compositional matrix adjust. Identities = 42/113 (37%), Positives = 60/113 (53%), Gaps = 10/113 (8%) Query: 13 LEVRNLRTHFYMPSG-----VLPAVDDVSLTLERGRILGLVGESGSGKTVTGFSILGLLD 67 L+ LR +++ G AVD V L L RG LG+VGESGSGK+ G ++L L Sbjct: 269 LQAERLRCTYHIKQGWFAKRAFHAVDGVDLQLRRGETLGIVGESGSGKSTLGMALLRLSA 328 Query: 68 APGRIVGGQILFKGQDLVTLDKKSLRSLQGNRIAMIFQDPMXP-SRRRSCRKC 119 A V G I F G + ++ LR L+ +R+ ++FQDP S RR+ + Sbjct: 329 AS---VAGSIRFDGVPISERPQRELRPLR-SRMQVVFQDPFASLSPRRTVEQI 377 >gi|300312477|ref|YP_003776569.1| oligopeptide ABC transporter ATPase [Herbaspirillum seropedicae SmR1] Length = 280 Score = 63.2 bits (152), Expect = 6e-12, Method: Compositional matrix adjust. Identities = 43/116 (37%), Positives = 56/116 (48%), Gaps = 20/116 (17%) Query: 4 MSATHSVPT------------LEVRNLRTHFYMPSGVLPAVDDVSLTLERGRILGLVGES 51 MS +H P +V L+ + P G L AV+DVSL L RG LGLVGES Sbjct: 1 MSNSHQAPAPLDDIALELCALTKVYPLKRGLFQPPGQLKAVNDVSLRLYRGETLGLVGES 60 Query: 52 GSGKTVTGFSILGLLDAPGRIVGGQILFKGQDLVTLDKKSLRSLQGNRIAMIFQDP 107 G GK+ +LGLL G +L GQ++ ++K+ I IFQDP Sbjct: 61 GCGKSTLAKMLLGLLPP----TSGNVLINGQEVDPTERKA----HARHIQPIFQDP 108 Database: BlastDatabases/689/689 Posted date: Apr 10, 2011 12:15 AM Number of letters in database: 1,619,870 Number of sequences in database: 4735 Lambda K H 0.322 0.138 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 4735 Number of Hits to DB: 375,259 Number of extensions: 16489 Number of successful extensions: 227 Number of sequences better than 1.0e-08: 10 Number of HSP's gapped: 237 Number of HSP's successfully gapped: 13 Length of query: 124 Length of database: 1,619,870 Length adjustment: 74 Effective length of query: 50 Effective length of database: 1,269,480 Effective search space: 63474000 Effective search space used: 63474000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 125 (52.8 bits)