BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0037.0067.p (138 letters) Database: BlastDatabases/689/689 4735 sequences; 1,619,870 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|300310896|ref|YP_003774988.1| oligopeptide ABC transporter AT... 102 1e-23 gi|300312478|ref|YP_003776570.1| dipeptide/oligopeptide/nickel A... 84 6e-18 gi|300311168|ref|YP_003775260.1| ABC transporter ATPase [Herbasp... 75 2e-15 gi|300310895|ref|YP_003774987.1| dipeptide/oligopeptide/nickel A... 72 2e-14 gi|300312477|ref|YP_003776569.1| oligopeptide ABC transporter AT... 62 2e-11 >gi|300310896|ref|YP_003774988.1| oligopeptide ABC transporter ATPase [Herbaspirillum seropedicae SmR1] Length = 335 Score = 102 bits (253), Expect = 1e-23, Method: Compositional matrix adjust. Identities = 51/112 (45%), Positives = 70/112 (62%), Gaps = 4/112 (3%) Query: 7 LFISHDLNVVRFISDRVLVMYLGQVVEIGSSDQVFDQPRHPYTRALLKSMPSMDPLQRTM 66 LFISHDL VV +SDRV++MYLG+VVE ++F QP HPYT+ALL +P M ++ Sbjct: 222 LFISHDLGVVEHVSDRVVIMYLGRVVESAPVAELFGQPNHPYTQALLAEVPRMGARKKEF 281 Query: 67 EAPLAGDPPNPINPPSGCRFHTRCAYARPVCGQRAPVFTSDESSGGGHGVAC 118 A + G+ P+P+NPP+GC F+ RC +A C + P+ GH AC Sbjct: 282 TA-IKGEIPSPLNPPTGCHFNPRCPHATQRCREEQPLL---REIAPGHMSAC 329 >gi|300312478|ref|YP_003776570.1| dipeptide/oligopeptide/nickel ABC transporter ATPase [Herbaspirillum seropedicae SmR1] Length = 334 Score = 83.6 bits (205), Expect = 6e-18, Method: Compositional matrix adjust. Identities = 49/117 (41%), Positives = 62/117 (52%), Gaps = 2/117 (1%) Query: 7 LFISHDLNVVRFISDRVLVMYLGQVVEIGSSDQVFDQPRHPYTRALLKSMPSM-DPLQRT 65 +FI+HDL VV I+DRV VMY GQVVE Q+F QPRHPYT+ LL +P L + Sbjct: 209 IFITHDLGVVSRIADRVAVMYAGQVVETTDVAQLFAQPRHPYTQGLLNCIPVRGKTLPGS 268 Query: 66 MEAPLAGDPPNPINPPSGCRFHTRCAYARPVCGQRAPVFTSDESSGGGHGVACLRYE 122 + G P+ + SGC F RCA A C +R P S H CL+ + Sbjct: 269 HLQAIPGVVPSLVGQVSGCAFRNRCAKADSGC-ERDPQMVQQGSVTAPHQARCLKLD 324 >gi|300311168|ref|YP_003775260.1| ABC transporter ATPase [Herbaspirillum seropedicae SmR1] Length = 617 Score = 75.1 bits (183), Expect = 2e-15, Method: Compositional matrix adjust. Identities = 37/74 (50%), Positives = 51/74 (68%), Gaps = 1/74 (1%) Query: 7 LFISHDLNVVRFISDRVLVMYLGQVVEIGSSDQVFDQPRHPYTRALLKSMPSMDP-LQRT 65 +FISHD+ VV IS RV VMYLGQ+VEIG +F+ P+HPYTR L+ ++P DP L++ Sbjct: 515 IFISHDMAVVERISHRVAVMYLGQIVEIGPRRAIFENPQHPYTRKLMAAVPVADPTLRQP 574 Query: 66 MEAPLAGDPPNPIN 79 + L + P+PI Sbjct: 575 GKKLLTDEIPSPIR 588 Score = 53.1 bits (126), Expect = 9e-09, Method: Compositional matrix adjust. Identities = 24/59 (40%), Positives = 41/59 (69%) Query: 7 LFISHDLNVVRFISDRVLVMYLGQVVEIGSSDQVFDQPRHPYTRALLKSMPSMDPLQRT 65 +FI+HD+ VV ++DRV+VM G+ VE + + +F P HPYT++LL ++P + ++ T Sbjct: 218 IFITHDMGVVAEVADRVVVMCRGEKVEENAVNPLFAAPAHPYTQSLLAAVPRLGSMRGT 276 >gi|300310895|ref|YP_003774987.1| dipeptide/oligopeptide/nickel ABC transporter ATPase [Herbaspirillum seropedicae SmR1] Length = 330 Score = 72.0 bits (175), Expect = 2e-14, Method: Compositional matrix adjust. Identities = 39/92 (42%), Positives = 54/92 (58%), Gaps = 3/92 (3%) Query: 7 LFISHDLNVVRFISDRVLVMYLGQVVEIGSSDQVFDQPRHPYTRALLKSMPSMDPL-QRT 65 ++I+HDL+VV ++D V VMY G++VE GS D V D P HPYT+ L+ S+PS + R Sbjct: 210 IWITHDLSVVAGLADEVAVMYAGRIVEQGSVDAVLDAPLHPYTQGLIGSLPSNNRRGARL 269 Query: 66 MEAPLAGDPPNPINPPSGCRFHTRCAYARPVC 97 + P G PN ++ P C F RC C Sbjct: 270 RQIP--GMTPNLLHLPPTCAFAARCERLSQQC 299 >gi|300312477|ref|YP_003776569.1| oligopeptide ABC transporter ATPase [Herbaspirillum seropedicae SmR1] Length = 280 Score = 61.6 bits (148), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 30/55 (54%), Positives = 38/55 (69%) Query: 7 LFISHDLNVVRFISDRVLVMYLGQVVEIGSSDQVFDQPRHPYTRALLKSMPSMDP 61 LFISHDL VV + DRV VM G +VE+ S +Q+F +P+H YTR LL S + DP Sbjct: 216 LFISHDLGVVEHLVDRVAVMNQGSIVELQSREQLFSEPQHLYTRMLLASALTPDP 270 Database: BlastDatabases/689/689 Posted date: Apr 10, 2011 12:15 AM Number of letters in database: 1,619,870 Number of sequences in database: 4735 Lambda K H 0.322 0.137 0.420 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 4735 Number of Hits to DB: 454,386 Number of extensions: 18659 Number of successful extensions: 127 Number of sequences better than 1.0e-08: 7 Number of HSP's gapped: 124 Number of HSP's successfully gapped: 8 Length of query: 138 Length of database: 1,619,870 Length adjustment: 76 Effective length of query: 62 Effective length of database: 1,260,010 Effective search space: 78120620 Effective search space used: 78120620 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 126 (53.1 bits)