BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0034.0433.p (361 letters) Database: BlastDatabases/689/689 4735 sequences; 1,619,870 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|300312677|ref|YP_003776769.1| two component hybrid sensor his... 85 8e-18 gi|300313029|ref|YP_003777121.1| two component hybrid sensor his... 70 3e-13 gi|300313023|ref|YP_003777115.1| hypothetical protein Hsero_3729... 67 3e-12 gi|300310566|ref|YP_003774658.1| Hpt sensor hybrid histidine kin... 60 2e-10 gi|300311948|ref|YP_003776040.1| sensor histidine kinase/respons... 59 9e-10 >gi|300312677|ref|YP_003776769.1| two component hybrid sensor histidine kinase/response regulator protein [Herbaspirillum seropedicae SmR1] Length = 1160 Score = 85.1 bits (209), Expect = 8e-18, Method: Compositional matrix adjust. Identities = 44/90 (48%), Positives = 62/90 (68%), Gaps = 4/90 (4%) Query: 105 DGQEAVDWLR---ERPQG-VDLVLMDIQMPVMDGYTATHEIRDTLGLRELPVIALTAGAF 160 +G+EA+ L+ ++P +DLVLMDI MP MDG TA EIR + LP+IALTA A Sbjct: 1066 NGREALQALQRSQDKPDAPIDLVLMDIMMPEMDGLTAMREIRKQAVWKRLPIIALTAKAM 1125 Query: 161 KAQQEAAMAAGMNGFLSKPYNVEQIISMVR 190 K QE +AAG N +++KP +VE+++S+VR Sbjct: 1126 KDDQEKCLAAGANDYIAKPLDVEKLLSLVR 1155 >gi|300313029|ref|YP_003777121.1| two component hybrid sensor histidine kinase/response regulator protein [Herbaspirillum seropedicae SmR1] Length = 1524 Score = 69.7 bits (169), Expect = 3e-13, Method: Compositional matrix adjust. Identities = 33/75 (44%), Positives = 48/75 (64%) Query: 121 DLVLMDIQMPVMDGYTATHEIRDTLGLRELPVIALTAGAFKAQQEAAMAAGMNGFLSKPY 180 DLVLMD+QMP MDG AT IR LR LP++A+TA A ++ + AGM G ++KP Sbjct: 1219 DLVLMDLQMPGMDGIEATRRIRGQYELRGLPILAMTANASPEDKQRCIEAGMAGHIAKPI 1278 Query: 181 NVEQIISMVRQHIAH 195 ++ +I ++ H+ H Sbjct: 1279 DIATLIPVLLAHLHH 1293 >gi|300313023|ref|YP_003777115.1| hypothetical protein Hsero_3729 [Herbaspirillum seropedicae SmR1] Length = 765 Score = 66.6 bits (161), Expect = 3e-12, Method: Compositional matrix adjust. Identities = 37/80 (46%), Positives = 50/80 (62%), Gaps = 5/80 (6%) Query: 105 DGQEAVDWLRERPQGVDLVLMDIQMPVMDGYTATHEIR---DTLGLRELPVIALTAGAFK 161 +G +AV+ +R DLVLMD MP+MDGY AT EIR GL P+IALTA A + Sbjct: 673 NGLQAVEAIRT--GHYDLVLMDCMMPIMDGYQATAEIRAHEAARGLPRTPIIALTASAIE 730 Query: 162 AQQEAAMAAGMNGFLSKPYN 181 ++ + AGM+ +LSKP+ Sbjct: 731 GDRQRCLDAGMDDYLSKPFT 750 >gi|300310566|ref|YP_003774658.1| Hpt sensor hybrid histidine kinase [Herbaspirillum seropedicae SmR1] Length = 723 Score = 60.5 bits (145), Expect = 2e-10, Method: Compositional matrix adjust. Identities = 36/92 (39%), Positives = 54/92 (58%), Gaps = 5/92 (5%) Query: 104 ADGQEAVDWL-RERPQGVDLVLMDIQMPVMDGYTATHEIRDTLG-LRELPVIALTAGAFK 161 A+G EA++ L R R LVLMD QMP++DGY T IR G L ++A+TA A Sbjct: 506 ANGLEALERLARHR---YALVLMDCQMPLLDGYETTRRIRRMQGELAHTTIVAMTANAMA 562 Query: 162 AQQEAAMAAGMNGFLSKPYNVEQIISMVRQHI 193 +E + AGM+ +L+KP Q+ +M+ ++ Sbjct: 563 GDRERCLEAGMDDYLTKPLLRSQLSAMLAHYL 594 >gi|300311948|ref|YP_003776040.1| sensor histidine kinase/response regulator protein [Herbaspirillum seropedicae SmR1] Length = 1145 Score = 58.5 bits (140), Expect = 9e-10, Method: Compositional matrix adjust. Identities = 28/73 (38%), Positives = 45/73 (61%), Gaps = 1/73 (1%) Query: 121 DLVLMDIQMPVMDGYTATHEIRDTLGLRELPVIALTAGAFKAQQEAAMAAGMNGFLSKPY 180 DLVL+DI MP MDG++ IR GL +LP++ ++A AF+ E +N F+ KP Sbjct: 978 DLVLLDIAMPQMDGWSVARAIRAR-GLAQLPILLVSANAFENLHERNEPPLVNDFVVKPV 1036 Query: 181 NVEQIISMVRQHI 193 + +++ +RQH+ Sbjct: 1037 SYHELLGKIRQHL 1049 Database: BlastDatabases/689/689 Posted date: Apr 10, 2011 12:15 AM Number of letters in database: 1,619,870 Number of sequences in database: 4735 Lambda K H 0.317 0.131 0.370 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 4735 Number of Hits to DB: 972,871 Number of extensions: 36640 Number of successful extensions: 308 Number of sequences better than 1.0e-08: 9 Number of HSP's gapped: 333 Number of HSP's successfully gapped: 9 Length of query: 361 Length of database: 1,619,870 Length adjustment: 86 Effective length of query: 275 Effective length of database: 1,212,660 Effective search space: 333481500 Effective search space used: 333481500 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 131 (55.1 bits)