BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0034.0128.p (74 letters) Database: BlastDatabases/689/689 4735 sequences; 1,619,870 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|300310594|ref|YP_003774686.1| methyl-accepting chemotaxis pro... 89 5e-20 gi|300312336|ref|YP_003776428.1| methyl-accepting chemotaxis tra... 76 5e-16 gi|300310668|ref|YP_003774760.1| methyl-accepting chemotaxis tra... 60 5e-11 gi|300313938|ref|YP_003778030.1| methyl-accepting chemotaxis tra... 54 2e-09 >gi|300310594|ref|YP_003774686.1| methyl-accepting chemotaxis protein I [Herbaspirillum seropedicae SmR1] Length = 541 Score = 89.4 bits (220), Expect = 5e-20, Method: Compositional matrix adjust. Identities = 37/70 (52%), Positives = 49/70 (70%) Query: 1 MNILANLKIGKRLALGFSIILLLAITIICIGIWRLQGVTDATKAMMQRPLEKERLISDWF 60 M AN+KIG+RLALGF++IL A ++ + IWRLQG+ AT MM PL KERL+SDW+ Sbjct: 1 MRYFANMKIGRRLALGFAVILAAASVVVALSIWRLQGIAAATDEMMHEPLTKERLVSDWY 60 Query: 61 PIVQTSITRV 70 + TS+ R Sbjct: 61 RTIHTSVRRT 70 >gi|300312336|ref|YP_003776428.1| methyl-accepting chemotaxis transducer transmembrane protein [Herbaspirillum seropedicae SmR1] Length = 536 Score = 76.3 bits (186), Expect = 5e-16, Method: Compositional matrix adjust. Identities = 32/60 (53%), Positives = 44/60 (73%) Query: 1 MNILANLKIGKRLALGFSIILLLAITIICIGIWRLQGVTDATKAMMQRPLEKERLISDWF 60 MNI+ N+ IG+RL LGF++IL +I I IG+WRL V AT+ MM PL+ ERL++DW+ Sbjct: 1 MNIIGNMNIGRRLTLGFALILTFSIIIAGIGLWRLDHVAQATREMMAEPLKTERLMADWY 60 >gi|300310668|ref|YP_003774760.1| methyl-accepting chemotaxis transducer transmembrane protein [Herbaspirillum seropedicae SmR1] Length = 515 Score = 59.7 bits (143), Expect = 5e-11, Method: Compositional matrix adjust. Identities = 25/67 (37%), Positives = 45/67 (67%) Query: 3 ILANLKIGKRLALGFSIILLLAITIICIGIWRLQGVTDATKAMMQRPLEKERLISDWFPI 62 ++ +++IG RL GF+++L+ ++ + +GIWRL+ V T+ MM PL+ ERL+S W + Sbjct: 1 MIKDIRIGSRLGAGFAVVLVFSMVVAAVGIWRLKTVAVQTQQMMDVPLKTERLVSQWNTL 60 Query: 63 VQTSITR 69 + +I R Sbjct: 61 LLIAIQR 67 >gi|300313938|ref|YP_003778030.1| methyl-accepting chemotaxis transducer transmembrane protein [Herbaspirillum seropedicae SmR1] Length = 533 Score = 54.3 bits (129), Expect = 2e-09, Method: Compositional matrix adjust. Identities = 26/66 (39%), Positives = 40/66 (60%) Query: 4 LANLKIGKRLALGFSIILLLAITIICIGIWRLQGVTDATKAMMQRPLEKERLISDWFPIV 63 + NLKIG RLA+GF +L+L ++ +G+WRL + DAT M + L+KER W + Sbjct: 1 MKNLKIGVRLAIGFIALLMLMAVMVALGVWRLGSIGDATDDMTRIALKKERDAVQWHAAI 60 Query: 64 QTSITR 69 + + R Sbjct: 61 KENGVR 66 Database: BlastDatabases/689/689 Posted date: Apr 10, 2011 12:15 AM Number of letters in database: 1,619,870 Number of sequences in database: 4735 Lambda K H 0.330 0.141 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 4735 Number of Hits to DB: 138,222 Number of extensions: 2802 Number of successful extensions: 33 Number of sequences better than 1.0e-08: 4 Number of HSP's gapped: 33 Number of HSP's successfully gapped: 4 Length of query: 74 Length of database: 1,619,870 Length adjustment: 45 Effective length of query: 29 Effective length of database: 1,406,795 Effective search space: 40797055 Effective search space used: 40797055 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 123 (52.0 bits)