BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0030.0004.p (111 letters) Database: BlastDatabases/689/689 4735 sequences; 1,619,870 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|300312621|ref|YP_003776713.1| ABC transporter ATPase [Herbasp... 191 1e-50 gi|300309717|ref|YP_003773809.1| nitrate/sulfonate/bicarbonate A... 74 3e-15 gi|300310542|ref|YP_003774634.1| nitrate transporter ATPase [Her... 67 4e-13 gi|300310980|ref|YP_003775072.1| alkanesulfonates ABC transporte... 62 1e-11 gi|300310818|ref|YP_003774910.1| nitrate/sulfonate/bicarbonate A... 61 2e-11 >gi|300312621|ref|YP_003776713.1| ABC transporter ATPase [Herbaspirillum seropedicae SmR1] Length = 257 Score = 191 bits (484), Expect = 1e-50, Method: Compositional matrix adjust. Identities = 95/111 (85%), Positives = 100/111 (90%), Gaps = 4/111 (3%) Query: 1 LLLDEPFGALDALTRMTLQDALRTLIRSEVQGKAPTVLLVTHDVDEALFLADRILVFSAR 60 LLLDEPFGALDALTRMTLQDALR LIR + PTV+LVTHDVDEALFLADRI VFS R Sbjct: 151 LLLDEPFGALDALTRMTLQDALRDLIRQQ----GPTVVLVTHDVDEALFLADRIFVFSPR 206 Query: 61 PATVLKEFNLVHHEKTHDLSEFSAIRREILCLLGIHAEQDEFAKTIEGVGI 111 PA VLKEFNLVHHEKTHDLSEF+AIRR+ILCLLGIHAEQDEFAK IEGVG+ Sbjct: 207 PAKVLKEFNLVHHEKTHDLSEFAAIRRDILCLLGIHAEQDEFAKNIEGVGV 257 >gi|300309717|ref|YP_003773809.1| nitrate/sulfonate/bicarbonate ABC transporter ATPase [Herbaspirillum seropedicae SmR1] Length = 269 Score = 73.9 bits (180), Expect = 3e-15, Method: Compositional matrix adjust. Identities = 43/91 (47%), Positives = 63/91 (69%), Gaps = 7/91 (7%) Query: 1 LLLDEPFGALDALTRMTLQDALRTLIRSEVQGKAPTVLLVTHDVDEALFLADRILVFSAR 60 +L+DEPFGALDALTR LQD L I E + T++ VTH ++EA++LADRI+V + R Sbjct: 162 MLMDEPFGALDALTRRNLQDEL-LRIWDEFRK---TIVFVTHSIEEAIYLADRIVVMTYR 217 Query: 61 PATVLKEFNLVHHEKTHDLS--EFSAIRREI 89 P TV ++ LV+ + D + EF+A++RE+ Sbjct: 218 PGTVKRDM-LVNLPRLRDPADPEFNALKREL 247 >gi|300310542|ref|YP_003774634.1| nitrate transporter ATPase [Herbaspirillum seropedicae SmR1] Length = 272 Score = 66.6 bits (161), Expect = 4e-13, Method: Compositional matrix adjust. Identities = 36/67 (53%), Positives = 46/67 (68%), Gaps = 4/67 (5%) Query: 1 LLLDEPFGALDALTRMTLQDALRTLIRSEVQGKAPTVLLVTHDVDEALFLADRILVFSAR 60 LL+DEPFGALDALTR LQD L + V TV++VTHDVDEA+ L+DRI++ + Sbjct: 166 LLMDEPFGALDALTRAHLQDELLKI----VAKTDSTVVMVTHDVDEAVLLSDRIVMMTNG 221 Query: 61 PATVLKE 67 PA + E Sbjct: 222 PAATIGE 228 >gi|300310980|ref|YP_003775072.1| alkanesulfonates ABC transporter ATPase [Herbaspirillum seropedicae SmR1] Length = 285 Score = 61.6 bits (148), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 39/91 (42%), Positives = 55/91 (60%), Gaps = 5/91 (5%) Query: 1 LLLDEPFGALDALTRMTLQDALRTLIRSEVQGKAPTVLLVTHDVDEALFLADRILVFSAR 60 LLLDEP GALDALTR+ +Q TLI S + + T LLVTHDV EA+ LADR+L+ Sbjct: 169 LLLDEPLGALDALTRIEMQ----TLIESLWRERGFTALLVTHDVQEAIALADRVLLIEDG 224 Query: 61 PATVLKEFNLVHHEKTHDLSEFSAIRREILC 91 + + +L ++ ++F+A+ IL Sbjct: 225 RVALDQRIDLA-RPRSRGQAQFAALEEAILA 254 >gi|300310818|ref|YP_003774910.1| nitrate/sulfonate/bicarbonate ABC transporter ATPase [Herbaspirillum seropedicae SmR1] Length = 265 Score = 60.8 bits (146), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 33/78 (42%), Positives = 45/78 (57%), Gaps = 4/78 (5%) Query: 1 LLLDEPFGALDALTRMTLQDALRTLIRSEVQGKAPTVLLVTHDVDEALFLADRILVFSAR 60 +L+DEPFGALDA TR LQ L + +S T++ VTHD+ EA+ LADR++ +A Sbjct: 155 VLMDEPFGALDAQTREVLQSELDRIWKS----TGCTIVFVTHDIWEAILLADRVVTMTAG 210 Query: 61 PATVLKEFNLVHHEKTHD 78 P +K VH D Sbjct: 211 PRAHIKTIEEVHLPHPRD 228 Database: BlastDatabases/689/689 Posted date: Apr 10, 2011 12:15 AM Number of letters in database: 1,619,870 Number of sequences in database: 4735 Lambda K H 0.324 0.140 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 4735 Number of Hits to DB: 322,246 Number of extensions: 11295 Number of successful extensions: 178 Number of sequences better than 1.0e-08: 12 Number of HSP's gapped: 176 Number of HSP's successfully gapped: 12 Length of query: 111 Length of database: 1,619,870 Length adjustment: 73 Effective length of query: 38 Effective length of database: 1,274,215 Effective search space: 48420170 Effective search space used: 48420170 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 124 (52.4 bits)