BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0028.0032.p (123 letters) Database: BlastDatabases/689/689 4735 sequences; 1,619,870 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|300311555|ref|YP_003775647.1| D-amino acid dehydrogenase smal... 124 2e-30 gi|300311013|ref|YP_003775105.1| glycine/D-amino acid oxidase [H... 80 6e-17 gi|300310779|ref|YP_003774871.1| D-amino acid dehydrogenase smal... 54 4e-09 >gi|300311555|ref|YP_003775647.1| D-amino acid dehydrogenase small subunit [Herbaspirillum seropedicae SmR1] Length = 423 Score = 124 bits (312), Expect = 2e-30, Method: Compositional matrix adjust. Identities = 63/115 (54%), Positives = 82/115 (71%), Gaps = 1/115 (0%) Query: 1 VGGGLSGVTTAYFLARAGFEVAVLERRANVAEEATFGNSGLLAPSVVQPLVLPAITRTAF 60 +GGGLSG+ +AYFLA G+EVAV+ERRA+VAEEATFG+SGLLAP PL LP T F Sbjct: 11 IGGGLSGICSAYFLATKGYEVAVIERRAHVAEEATFGDSGLLAPGTAMPLTLPGALAT-F 69 Query: 61 SNLFKSEPPILVKSGFNPSRWRWVRKSRREYQDYFSLNKQRLTRLSAYGXRLLQR 115 + F+ EP +L+ SG + R RW+R +R Q +F+ +K L+RLSAYG L Q+ Sbjct: 70 ACRFQDEPRVLLASGADFGRRRWMRATRAAQQHHFAQHKLILSRLSAYGQDLTQQ 124 >gi|300311013|ref|YP_003775105.1| glycine/D-amino acid oxidase [Herbaspirillum seropedicae SmR1] Length = 433 Score = 79.7 bits (195), Expect = 6e-17, Method: Compositional matrix adjust. Identities = 41/116 (35%), Positives = 67/116 (57%), Gaps = 3/116 (2%) Query: 1 VGGGLSGVTTAYFLARAGFEVAVLERRANVAEEATFGNSGLLAPSVVQPLVLPAITRTAF 60 +G G+ GVT+A++LARAG +V VL+R+ A E +FGN+G ++P P P I A Sbjct: 6 LGSGVIGVTSAWYLARAGHDVTVLDRQPGPALETSFGNAGQISPGYASPWAAPGIPLKAI 65 Query: 61 SNLFKSEPPILVK--SGFNPSRWRWVRKSRREYQDYFSLNKQRLTRLSAYGXRLLQ 114 +F+ P+ ++ FN RW W + R + +++NK+R+ RL+ Y L+ Sbjct: 66 KWMFQEHAPLAIRLDGSFNQLRWMW-QMLRNCNAERYAVNKERMVRLAEYSRDCLR 120 >gi|300310779|ref|YP_003774871.1| D-amino acid dehydrogenase small subunit [Herbaspirillum seropedicae SmR1] Length = 436 Score = 53.9 bits (128), Expect = 4e-09, Method: Compositional matrix adjust. Identities = 33/117 (28%), Positives = 56/117 (47%), Gaps = 5/117 (4%) Query: 1 VGGGLSGVTTAYFLARAGFEVAVLERRANVAEEATFGNSGLLAPSVVQPLVLPAITRTAF 60 +G G+ G +A+FL + G++V V++R+ A+E +F N ++ S +P PA Sbjct: 6 LGAGIIGTASAWFLKKQGYDVTVIDRQPGAAQETSFANGCQISVSHAEPWANPAAPMKVL 65 Query: 61 SNLFKSEPPILVKSGFNPS--RWRWVRKSRREYQDY-FSLNKQRLTRLSAYGXRLLQ 114 L K + P+L + F P +W+W RE N + + L Y + LQ Sbjct: 66 KWLGKEDAPLLYR--FRPEWLQWKWAVAFLRECTAARTDENIRNIVALCEYSRQTLQ 120 Database: BlastDatabases/689/689 Posted date: Apr 10, 2011 12:15 AM Number of letters in database: 1,619,870 Number of sequences in database: 4735 Lambda K H 0.320 0.136 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 4735 Number of Hits to DB: 339,600 Number of extensions: 12285 Number of successful extensions: 72 Number of sequences better than 1.0e-08: 3 Number of HSP's gapped: 71 Number of HSP's successfully gapped: 3 Length of query: 123 Length of database: 1,619,870 Length adjustment: 74 Effective length of query: 49 Effective length of database: 1,269,480 Effective search space: 62204520 Effective search space used: 62204520 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 125 (52.8 bits)