BLASTP 2.2.18 [Mar-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 0028.0023.p
         (94 letters)

Database: BlastDatabases/689/689 
           4735 sequences; 1,619,870 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|300313094|ref|YP_003777186.1| hypothetical protein Hsero_3800...    90   3e-20

>gi|300313094|ref|YP_003777186.1| hypothetical protein Hsero_3800
          [Herbaspirillum seropedicae SmR1]
          Length = 75

 Score = 90.1 bits (222), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 41/71 (57%), Positives = 52/71 (73%)

Query: 21 MTKLEEIVKRQKQGAKFVLSFQMLGMDVETFDTVAQTWLEHGGPGFEAAGVPFRKVIDGE 80
          M KLE+IV++QK GA FV+S QML M    FD +AQ W + GGPGF  A VPFR V++ E
Sbjct: 1  MAKLEDIVRKQKPGATFVISAQMLQMSPREFDALAQVWDDEGGPGFNVAAVPFRVVVEDE 60

Query: 81 FLIARLTVVKT 91
          F I+R+TVV+T
Sbjct: 61 FFISRVTVVRT 71


  Database: BlastDatabases/689/689
    Posted date:  Apr 10, 2011 12:15 AM
  Number of letters in database: 1,619,870
  Number of sequences in database:  4735
  
Lambda     K      H
   0.318    0.134    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 4735
Number of Hits to DB: 285,222
Number of extensions: 9942
Number of successful extensions: 34
Number of sequences better than 1.0e-08: 1
Number of HSP's gapped: 34
Number of HSP's successfully gapped: 1
Length of query: 94
Length of database: 1,619,870
Length adjustment: 63
Effective length of query: 31
Effective length of database: 1,321,565
Effective search space: 40968515
Effective search space used: 40968515
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 123 (52.0 bits)