BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0023.0040.p (121 letters) Database: BlastDatabases/689/689 4735 sequences; 1,619,870 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|300310698|ref|YP_003774790.1| AraC family two-component hybri... 85 1e-18 gi|300313896|ref|YP_003777988.1| two component transcription res... 79 1e-16 gi|300312680|ref|YP_003776772.1| two component response regulato... 79 1e-16 gi|300313830|ref|YP_003777922.1| response regulator protein [Her... 77 3e-16 gi|300311339|ref|YP_003775431.1| CheY chemotaxis protein [Herbas... 77 6e-16 >gi|300310698|ref|YP_003774790.1| AraC family two-component hybrid sensor/regulator transcription regulator protein [Herbaspirillum seropedicae SmR1] Length = 262 Score = 85.1 bits (209), Expect = 1e-18, Method: Compositional matrix adjust. Identities = 40/110 (36%), Positives = 65/110 (59%) Query: 4 KKILVVDDSPTDRYLLTEILSKHGFDVDTADNGEEALGKIRCNRPELVLMDVVMPGKNGF 63 ++ILVVDD+ DR LL+ L +HG + +G++ K + RP+L+LMD+ MPG +G Sbjct: 17 QRILVVDDAEDDRTLLSGFLLRHGVRLYIGTDGQDGYRKAQTVRPDLILMDIRMPGYDGL 76 Query: 64 QMTRQMTRDPSLKDIPIMMCSIKDQETDRIWALSQGACDYVVKPVDALEL 113 R + + S ++IP++ S +++ LS GA DY+ KP D E+ Sbjct: 77 TSCRLLKANTSTRNIPVIFLSAATTTEEKVTGLSTGAVDYITKPFDFEEV 126 >gi|300313896|ref|YP_003777988.1| two component transcription response regulator protein [Herbaspirillum seropedicae SmR1] Length = 244 Score = 78.6 bits (192), Expect = 1e-16, Method: Compositional matrix adjust. Identities = 38/116 (32%), Positives = 71/116 (61%), Gaps = 4/116 (3%) Query: 6 ILVVDDSPTDRYLLTEILSKHGFDVDTADNGEEALGKIRCNRPELVLMDVVMPGKNGFQM 65 IL+V+D P LL + L+ G+ G+ AL +R RP+L+L+D+++PG +G+++ Sbjct: 18 ILIVEDEPKLAELLQKYLALAGYSARHVARGDAALDAVRAQRPDLILLDIMLPGMDGWEI 77 Query: 66 TRQMTRDPSLKDIPIMMCSIKDQETDRIWALSQGACDYVVK-PVDALELLAKIAAI 120 RQ+ + D+P++M + + +E DR+ L GA DY+ K P E++A++ ++ Sbjct: 78 CRQLR---TFSDVPVLMLTARAEEEDRLRGLELGADDYIGKTPFSPREIVARVKSM 130 >gi|300312680|ref|YP_003776772.1| two component response regulator protein [Herbaspirillum seropedicae SmR1] Length = 220 Score = 78.6 bits (192), Expect = 1e-16, Method: Compositional matrix adjust. Identities = 44/116 (37%), Positives = 71/116 (61%), Gaps = 4/116 (3%) Query: 5 KILVVDDSPTDRYLLTEILSKHGFDVDTADNGEEALGKIRCNRPELVLMDVVMPGKNGFQ 64 +L+V+D P L+ +L+ HGF V T +NG +AL + R N LVL D+ +PG +GF+ Sbjct: 2 NVLLVEDDPVLTDGLSRVLNSHGFTVHTVNNGNDALSQ-RFNAAVLVL-DIGLPGIDGFE 59 Query: 65 MTRQMTRDPSLKDIPIMMCSIKDQETDRIWALSQGACDYVVKPVDALELLAKIAAI 120 + R+M + + P+++ + +D DR+ L GA DY+VKP EL+A+I A+ Sbjct: 60 VLRRMR--AAGNNTPVLLLTARDTIPDRVHGLELGADDYLVKPFATPELVARIKAL 113 >gi|300313830|ref|YP_003777922.1| response regulator protein [Herbaspirillum seropedicae SmR1] Length = 237 Score = 77.4 bits (189), Expect = 3e-16, Method: Compositional matrix adjust. Identities = 43/119 (36%), Positives = 68/119 (57%), Gaps = 5/119 (4%) Query: 4 KKILVVDDSPTDRYLLTEILSKHGFDVDTADNGEEALGKIR--CNRPELVLMDVVMPGKN 61 +KIL+VDD R LL L K+ ++V A +G L + + + LV++DV++P + Sbjct: 3 RKILIVDDDQKTRTLLKAYLEKNQYEVRLAHDGATFLAEFQRLADELSLVILDVMLPDTD 62 Query: 62 GFQMTRQMTRDPSLKDIPIMMCSIKDQETDRIWALSQGACDYVVKPVDALELLAKIAAI 120 GF + + + R ++P++M + ETDR+ L GA DY+ KP ELLA+I AI Sbjct: 63 GFALCKAVRRK---SNVPVIMLTASSDETDRVVGLELGADDYIAKPYSPRELLARIKAI 118 >gi|300311339|ref|YP_003775431.1| CheY chemotaxis protein [Herbaspirillum seropedicae SmR1] Length = 131 Score = 76.6 bits (187), Expect = 6e-16, Method: Compositional matrix adjust. Identities = 41/117 (35%), Positives = 71/117 (60%), Gaps = 1/117 (0%) Query: 5 KILVVDDSPTDRYLLTEILSKHGF-DVDTADNGEEALGKIRCNRPELVLMDVVMPGKNGF 63 K LVVDD T R ++ +L + G+ +VD A++G +AL K+R ++ + V+ D MP +G Sbjct: 7 KFLVVDDFSTMRRIVRNLLKELGYTNVDEAEDGVQALQKLRSDQFDFVVSDWNMPNMDGL 66 Query: 64 QMTRQMTRDPSLKDIPIMMCSIKDQETDRIWALSQGACDYVVKPVDALELLAKIAAI 120 M +++ +DP+L +P++M + + ++ + + A GA YVVKP A L K+ I Sbjct: 67 TMLQEIRKDPALSKLPVLMVTAEAKKENIVAAAQAGANGYVVKPFTAATLDEKLGKI 123 Database: BlastDatabases/689/689 Posted date: Apr 10, 2011 12:15 AM Number of letters in database: 1,619,870 Number of sequences in database: 4735 Lambda K H 0.321 0.138 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 4735 Number of Hits to DB: 362,354 Number of extensions: 12974 Number of successful extensions: 161 Number of sequences better than 1.0e-08: 48 Number of HSP's gapped: 153 Number of HSP's successfully gapped: 49 Length of query: 121 Length of database: 1,619,870 Length adjustment: 74 Effective length of query: 47 Effective length of database: 1,269,480 Effective search space: 59665560 Effective search space used: 59665560 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 125 (52.8 bits)