BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0013.0213.p (229 letters) Database: BlastDatabases/689/689 4735 sequences; 1,619,870 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|300311759|ref|YP_003775851.1| short-chain alcohol dehydrogena... 84 8e-18 gi|300311727|ref|YP_003775819.1| dehydrogenase [Herbaspirillum s... 83 2e-17 gi|300309919|ref|YP_003774011.1| 3-oxoacyl-(acyl-carrier protein... 70 2e-13 gi|300311869|ref|YP_003775961.1| short-chain alcohol dehydrogena... 64 1e-11 gi|300311568|ref|YP_003775660.1| toluenesulfonate Zinc-independe... 60 2e-10 >gi|300311759|ref|YP_003775851.1| short-chain alcohol dehydrogenase [Herbaspirillum seropedicae SmR1] Length = 247 Score = 84.3 bits (207), Expect = 8e-18, Method: Compositional matrix adjust. Identities = 48/127 (37%), Positives = 72/127 (56%), Gaps = 2/127 (1%) Query: 29 VLVNNAGYGHEGIFEESGMEALQRQFDVNVFGAVAVTKGFVPFMRQRRRGHIINITSMGG 88 VLVNNAG G+ G E M ++ F+ N G++A+T+ F+P MR R +G +IN+TS Sbjct: 71 VLVNNAGIGNLGALEAQPMAQVRELFETNTLGSIAMTQAFIPQMRARGQGLVINVTSSVT 130 Query: 89 IITMPGIAYYCGSKFALEGISETLGKELKAFDIFVTAVAPG-SFRTDWAGRSMVRSPRSI 147 + +P +A Y SK A+ +E+L EL + V V PG S +T +A + R S+ Sbjct: 131 LRALPLLAVYTASKAAINAFTESLALELAPLGVQVRLVLPGRSPQTRFAENARARMAASV 190 Query: 148 AD-YDAL 153 + Y AL Sbjct: 191 PEPYAAL 197 >gi|300311727|ref|YP_003775819.1| dehydrogenase [Herbaspirillum seropedicae SmR1] Length = 247 Score = 83.2 bits (204), Expect = 2e-17, Method: Compositional matrix adjust. Identities = 43/101 (42%), Positives = 59/101 (58%) Query: 29 VLVNNAGYGHEGIFEESGMEALQRQFDVNVFGAVAVTKGFVPFMRQRRRGHIINITSMGG 88 VLVNNAG G G FE + M ++ F+ N FG +A+ + +P R+R G IIN+TS Sbjct: 71 VLVNNAGIGLFGAFEATPMSTVREIFETNTFGVMAMCQAVIPQFRERGDGVIINVTSSAT 130 Query: 89 IITMPGIAYYCGSKFALEGISETLGKELKAFDIFVTAVAPG 129 + P +A Y SK A+EG + +L ELKA + V V PG Sbjct: 131 LAAFPLVAAYTASKTAIEGFTASLAHELKAVGVRVKLVEPG 171 >gi|300309919|ref|YP_003774011.1| 3-oxoacyl-(acyl-carrier protein) reductase [Herbaspirillum seropedicae SmR1] Length = 244 Score = 70.1 bits (170), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 36/110 (32%), Positives = 56/110 (50%), Gaps = 1/110 (0%) Query: 30 LVNNAGYGHEGI-FEESGMEALQRQFDVNVFGAVAVTKGFVPFMRQRRRGHIINITSMGG 88 L+NNAGY + +E + R VN+ G + P MR RRG I+NI S+ G Sbjct: 82 LINNAGYAGPTVPLDEYDVGEWHRIVQVNLLGVFHACRSVTPAMRAARRGRIVNIASLAG 141 Query: 89 IITMPGIAYYCGSKFALEGISETLGKELKAFDIFVTAVAPGSFRTDWAGR 138 P + Y +K + ++++LGKEL + V A+AP + +T G+ Sbjct: 142 KEGTPNASAYSAAKAGVLALTKSLGKELAESGVLVNAIAPAAVKTALLGQ 191 >gi|300311869|ref|YP_003775961.1| short-chain alcohol dehydrogenase [Herbaspirillum seropedicae SmR1] Length = 257 Score = 63.9 bits (154), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 39/112 (34%), Positives = 55/112 (49%), Gaps = 2/112 (1%) Query: 26 HQAVLVNNAGYGHEGIFEESGMEALQRQFDVNVFGAVAVTKGFVPFMRQRRRGHIINITS 85 H LVNN G G EE+ F V++ G +T+ +P + Q G IINI+S Sbjct: 92 HFHYLVNNGGMGMHASIEETSEAVFDALFKVHLKGPFFLTQALLPLLAQG--GRIINISS 149 Query: 86 MGGIITMPGIAYYCGSKFALEGISETLGKELKAFDIFVTAVAPGSFRTDWAG 137 ++PG A Y K +E ++ + KE A I V VAPG+ TD+ G Sbjct: 150 GLARFSLPGYAAYASMKGGVEVMTRYMAKEFGARGIVVNTVAPGAIETDFGG 201 >gi|300311568|ref|YP_003775660.1| toluenesulfonate Zinc-independent alcohol dehydrogenase [Herbaspirillum seropedicae SmR1] Length = 252 Score = 59.7 bits (143), Expect = 2e-10, Method: Compositional matrix adjust. Identities = 39/109 (35%), Positives = 53/109 (48%), Gaps = 1/109 (0%) Query: 21 IQNFFHQAVLVNNAGYGHEG-IFEESGMEALQRQFDVNVFGAVAVTKGFVPFMRQRRRGH 79 +++F ++VNNAG H E + R + VNV K FVP+ RQ G Sbjct: 77 LEHFGKLDIVVNNAGTTHRNRPMLEVEEDEFDRVYAVNVKSIFLSAKTFVPYFRQVGGGA 136 Query: 80 IINITSMGGIITMPGIAYYCGSKFALEGISETLGKELKAFDIFVTAVAP 128 INI S GI PG+ +Y GSK A+ S+++ EL I V V P Sbjct: 137 FINIASTAGIRPRPGLTWYNGSKGAVITTSKSMAAELGPDKIRVNCVNP 185 Database: BlastDatabases/689/689 Posted date: Apr 10, 2011 12:15 AM Number of letters in database: 1,619,870 Number of sequences in database: 4735 Lambda K H 0.325 0.137 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 4735 Number of Hits to DB: 622,630 Number of extensions: 22530 Number of successful extensions: 119 Number of sequences better than 1.0e-08: 11 Number of HSP's gapped: 130 Number of HSP's successfully gapped: 11 Length of query: 229 Length of database: 1,619,870 Length adjustment: 82 Effective length of query: 147 Effective length of database: 1,231,600 Effective search space: 181045200 Effective search space used: 181045200 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 129 (54.3 bits)