BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0010.0006.p (76 letters) Database: BlastDatabases/689/689 4735 sequences; 1,619,870 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|300311799|ref|YP_003775891.1| two component heavy metal respo... 145 9e-37 gi|300312356|ref|YP_003776448.1| cobalt/zinc/cadmium resistance ... 95 1e-21 gi|300309361|ref|YP_003773453.1| response regulator for cobalt/z... 82 7e-18 gi|300313818|ref|YP_003777910.1| two component transcription reg... 62 1e-11 gi|300313896|ref|YP_003777988.1| two component transcription res... 58 2e-10 >gi|300311799|ref|YP_003775891.1| two component heavy metal response transcription regulator protein [Herbaspirillum seropedicae SmR1] Length = 230 Score = 145 bits (365), Expect = 9e-37, Method: Compositional matrix adjust. Identities = 67/75 (89%), Positives = 72/75 (96%) Query: 1 MKILIVEDEHKMAEYLCKGLTEQGCTVDLAANGIDGQHLAIQHDYDVIVLDVMLPGLDGF 60 MKILIVEDE KM+EYLCKGLTEQGC VDLAANG+DGQHLAI+HDYDVIVLDVMLPGLDGF Sbjct: 1 MKILIVEDEQKMSEYLCKGLTEQGCAVDLAANGVDGQHLAIEHDYDVIVLDVMLPGLDGF 60 Query: 61 SVLRSLRTVKQTPVI 75 SVLR+LR VK+TPVI Sbjct: 61 SVLRALRKVKETPVI 75 >gi|300312356|ref|YP_003776448.1| cobalt/zinc/cadmium resistance two component response regulator protein [Herbaspirillum seropedicae SmR1] Length = 223 Score = 94.7 bits (234), Expect = 1e-21, Method: Compositional matrix adjust. Identities = 42/75 (56%), Positives = 57/75 (76%) Query: 1 MKILIVEDEHKMAEYLCKGLTEQGCTVDLAANGIDGQHLAIQHDYDVIVLDVMLPGLDGF 60 M IL++ED+ K +YL KGL E G VDLA NG DG H+A++ DYD++VLDVMLPGLDG+ Sbjct: 1 MAILVIEDDPKTGDYLRKGLRESGYAVDLARNGADGLHMALEQDYDLVVLDVMLPGLDGW 60 Query: 61 SVLRSLRTVKQTPVI 75 V+ +LR+ + PV+ Sbjct: 61 QVMSALRSKRDLPVL 75 >gi|300309361|ref|YP_003773453.1| response regulator for cobalt/zinc/cadmium resistance transcription regulator protein [Herbaspirillum seropedicae SmR1] Length = 235 Score = 82.4 bits (202), Expect = 7e-18, Method: Composition-based stats. Identities = 40/75 (53%), Positives = 51/75 (68%) Query: 1 MKILIVEDEHKMAEYLCKGLTEQGCTVDLAANGIDGQHLAIQHDYDVIVLDVMLPGLDGF 60 M IL+VEDE K +YL +GLTE G VD G+DG H A DY +I+LDVMLPG++G+ Sbjct: 1 MHILLVEDEPKSGDYLRRGLTESGFVVDWVQTGVDGLHNARTLDYKLIILDVMLPGMNGW 60 Query: 61 SVLRSLRTVKQTPVI 75 +LR LR TPV+ Sbjct: 61 DILRELRRTHDTPVL 75 >gi|300313818|ref|YP_003777910.1| two component transcription regulator protein [Herbaspirillum seropedicae SmR1] Length = 224 Score = 61.6 bits (148), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 29/76 (38%), Positives = 48/76 (63%), Gaps = 1/76 (1%) Query: 1 MKILIVEDEHKMAEYLCKGLTEQGCTVDLAANGIDGQHLAIQHDYDVIVLDVMLPGLDGF 60 M+IL+VED +++ +L K + + TV+ A NG D L + DY +++LD+ LP +DG Sbjct: 1 MRILLVEDHIELSRWLAKAMRDAHLTVECAHNGADADSLLLTQDYALVILDLTLPRMDGM 60 Query: 61 SVLRSLRTV-KQTPVI 75 VL+ +R +TPV+ Sbjct: 61 EVLKRMRARGNRTPVL 76 >gi|300313896|ref|YP_003777988.1| two component transcription response regulator protein [Herbaspirillum seropedicae SmR1] Length = 244 Score = 57.8 bits (138), Expect = 2e-10, Method: Composition-based stats. Identities = 32/73 (43%), Positives = 41/73 (56%) Query: 3 ILIVEDEHKMAEYLCKGLTEQGCTVDLAANGIDGQHLAIQHDYDVIVLDVMLPGLDGFSV 62 ILIVEDE K+AE L K L G + A G D+I+LD+MLPG+DG+ + Sbjct: 18 ILIVEDEPKLAELLQKYLALAGYSARHVARGDAALDAVRAQRPDLILLDIMLPGMDGWEI 77 Query: 63 LRSLRTVKQTPVI 75 R LRT PV+ Sbjct: 78 CRQLRTFSDVPVL 90 Database: BlastDatabases/689/689 Posted date: Apr 10, 2011 12:15 AM Number of letters in database: 1,619,870 Number of sequences in database: 4735 Lambda K H 0.323 0.141 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 4735 Number of Hits to DB: 228,815 Number of extensions: 7860 Number of successful extensions: 94 Number of sequences better than 1.0e-08: 11 Number of HSP's gapped: 105 Number of HSP's successfully gapped: 11 Length of query: 76 Length of database: 1,619,870 Length adjustment: 47 Effective length of query: 29 Effective length of database: 1,397,325 Effective search space: 40522425 Effective search space used: 40522425 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 123 (52.0 bits)