BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0009.0179.p (148 letters) Database: BlastDatabases/689/689 4735 sequences; 1,619,870 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|300311014|ref|YP_003775106.1| leucine-responsive regulatory D... 209 7e-56 gi|300309515|ref|YP_003773607.1| leucine-responsive regulatory p... 113 8e-27 gi|300312490|ref|YP_003776582.1| transcription regulator protein... 77 8e-16 gi|300311006|ref|YP_003775098.1| transcription regulator protein... 72 1e-14 gi|300310455|ref|YP_003774547.1| AsnC family transcription regul... 60 8e-11 >gi|300311014|ref|YP_003775106.1| leucine-responsive regulatory DNA-binding transcription regulator protein [Herbaspirillum seropedicae SmR1] Length = 162 Score = 209 bits (532), Expect = 7e-56, Method: Compositional matrix adjust. Identities = 98/106 (92%), Positives = 105/106 (99%) Query: 43 LSGYYARIDPATLGATLLVFVEITLNHKSGNMFEQFRREVLRIPEVQECHLVSGDFDYLI 102 ++GYYAR++P +LGATLLVFVEITLNHKSGNMFEQFRREVLRIPEVQECHLVSGDFDYLI Sbjct: 57 ITGYYARVNPESLGATLLVFVEITLNHKSGNMFEQFRREVLRIPEVQECHLVSGDFDYLI 116 Query: 103 KARIRGMAEYRKLLGDILLQLPGAAQSKSYVVMEEIKETLALPLEE 148 KARIRGMAEYRKLLGDILLQLPGAAQSKSYVVMEEIKETLALPL++ Sbjct: 117 KARIRGMAEYRKLLGDILLQLPGAAQSKSYVVMEEIKETLALPLDD 162 >gi|300309515|ref|YP_003773607.1| leucine-responsive regulatory protein [Herbaspirillum seropedicae SmR1] Length = 154 Score = 113 bits (282), Expect = 8e-27, Method: Compositional matrix adjust. Identities = 47/102 (46%), Positives = 74/102 (72%) Query: 45 GYYARIDPATLGATLLVFVEITLNHKSGNMFEQFRREVLRIPEVQECHLVSGDFDYLIKA 104 GY A+++P L +LLVF+E+ L+ + ++F +F++ V IPE+ ECH+V+G FDYL+K+ Sbjct: 52 GYAAQLNPELLDVSLLVFIEVVLDRTTPDVFAEFKKSVQSIPEIMECHMVAGGFDYLVKS 111 Query: 105 RIRGMAEYRKLLGDILLQLPGAAQSKSYVVMEEIKETLALPL 146 R++ M YR+ LG LLQL G ++ +Y VMEE+K T+ LP+ Sbjct: 112 RVKDMNAYREFLGKSLLQLKGVRETHTYAVMEEVKNTIRLPI 153 >gi|300312490|ref|YP_003776582.1| transcription regulator protein [Herbaspirillum seropedicae SmR1] Length = 153 Score = 76.6 bits (187), Expect = 8e-16, Method: Compositional matrix adjust. Identities = 37/98 (37%), Positives = 59/98 (60%) Query: 50 IDPATLGATLLVFVEITLNHKSGNMFEQFRREVLRIPEVQECHLVSGDFDYLIKARIRGM 109 +DP LG +LV V + L+ + F +F + V I VQEC L++G+FDY IK R++ + Sbjct: 56 LDPEKLGLPVLVTVGVVLDRSTPESFAEFEKAVRDIAAVQECLLLAGEFDYWIKLRVKDL 115 Query: 110 AEYRKLLGDILLQLPGAAQSKSYVVMEEIKETLALPLE 147 + +L + LL+LPG Q +S+ V+ E+K L +E Sbjct: 116 QAFNRLHANTLLRLPGVRQLRSFFVLNEVKNNPELVVE 153 >gi|300311006|ref|YP_003775098.1| transcription regulator protein [Herbaspirillum seropedicae SmR1] Length = 172 Score = 72.4 bits (176), Expect = 1e-14, Method: Compositional matrix adjust. Identities = 39/119 (32%), Positives = 68/119 (57%), Gaps = 1/119 (0%) Query: 29 ISRYYARIDPATLGLSGYYARIDPATLGATLLVFVEITLNHKSGNMFEQFRREVLRIPEV 88 ISR R++ A + + Y A +DPA +G + F +TL+ + E F + V +PEV Sbjct: 39 ISRRVQRLEEAHV-IERYTAVLDPAVVGLGVTAFTTVTLDRQGETRGELFEKAVETMPEV 97 Query: 89 QECHLVSGDFDYLIKARIRGMAEYRKLLGDILLQLPGAAQSKSYVVMEEIKETLALPLE 147 EC V+G+ DY+++ +A + + + LL+LPG KS + ++++K++ LPLE Sbjct: 98 TECFSVTGEGDYILRIVAPDLAAFSEFMMTRLLRLPGVTNVKSNITLKKVKQSHELPLE 156 >gi|300310455|ref|YP_003774547.1| AsnC family transcription regulator protein [Herbaspirillum seropedicae SmR1] Length = 164 Score = 60.1 bits (144), Expect = 8e-11, Method: Compositional matrix adjust. Identities = 35/106 (33%), Positives = 55/106 (51%) Query: 43 LSGYYARIDPATLGATLLVFVEITLNHKSGNMFEQFRREVLRIPEVQECHLVSGDFDYLI 102 +SGY A I L +VF E+TL+ F +F + + E+ ECHLVSG +DYL+ Sbjct: 55 ISGYGAYIRLEKLADVQIVFTEVTLSDHRREDFAKFESTIRNVDEIIECHLVSGGYDYLL 114 Query: 103 KARIRGMAEYRKLLGDILLQLPGAAQSKSYVVMEEIKETLALPLEE 148 K R + Y+ ++ +L Q + SY+V++ PLE+ Sbjct: 115 KFMTRSVVHYQSVIESLLEQNLRIEKYFSYIVIKSPFVKHHYPLEK 160 Database: BlastDatabases/689/689 Posted date: Apr 10, 2011 12:15 AM Number of letters in database: 1,619,870 Number of sequences in database: 4735 Lambda K H 0.321 0.137 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 4735 Number of Hits to DB: 408,342 Number of extensions: 14932 Number of successful extensions: 53 Number of sequences better than 1.0e-08: 7 Number of HSP's gapped: 52 Number of HSP's successfully gapped: 7 Length of query: 148 Length of database: 1,619,870 Length adjustment: 77 Effective length of query: 71 Effective length of database: 1,255,275 Effective search space: 89124525 Effective search space used: 89124525 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 126 (53.1 bits)