BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0004.0091.p (143 letters) Database: BlastDatabases/689/689 4735 sequences; 1,619,870 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|300309514|ref|YP_003773606.1| AraC family transcription regul... 71 3e-14 gi|300313807|ref|YP_003777899.1| AraC family transcription regul... 62 2e-11 gi|300313797|ref|YP_003777889.1| AraC family transcription regul... 62 3e-11 gi|300311726|ref|YP_003775818.1| AraC family transcription regul... 59 1e-10 gi|300311694|ref|YP_003775786.1| AraC family transcription regul... 58 3e-10 >gi|300309514|ref|YP_003773606.1| AraC family transcription regulator protein [Herbaspirillum seropedicae SmR1] Length = 323 Score = 71.2 bits (173), Expect = 3e-14, Method: Compositional matrix adjust. Identities = 38/99 (38%), Positives = 56/99 (56%) Query: 1 MDAASHEDWPVERLASVSHVSEAHFARAFKEAFGTPPHRYLLTRRIERAAALLRDSELPI 60 M A EDW + RLA++ H+S A F R F E + P + L+ R+ +AA LL S+ Sbjct: 222 MLKAPAEDWSLPRLAALCHMSRATFIRRFAEVGASTPAQVLMQLRMAQAARLLSYSKQAT 281 Query: 61 TEIAFRTGWRSLGTFGRIFREITGDNPGTVRKQARIAAQ 99 +I G++S F R+FR+ +G PG R+QAR A + Sbjct: 282 AQIGEAVGYQSEAAFNRVFRKYSGMGPGAYRRQARAAGE 320 >gi|300313807|ref|YP_003777899.1| AraC family transcription regulator protein [Herbaspirillum seropedicae SmR1] Length = 299 Score = 62.0 bits (149), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 28/85 (32%), Positives = 49/85 (57%) Query: 11 VERLASVSHVSEAHFARAFKEAFGTPPHRYLLTRRIERAAALLRDSELPITEIAFRTGWR 70 + +A ++S ++F RAFK + G PH++L+ +R+E A LR ++L + EIA + Sbjct: 215 IPEIARECNMSASYFLRAFKASTGHTPHQWLMVQRVEMAQQYLRSTQLTLAEIALACDFY 274 Query: 71 SLGTFGRIFREITGDNPGTVRKQAR 95 F R+F ++ G PG R++ R Sbjct: 275 DQSHFSRVFSQVVGSTPGAWRRRLR 299 >gi|300313797|ref|YP_003777889.1| AraC family transcription regulator protein [Herbaspirillum seropedicae SmR1] Length = 294 Score = 61.6 bits (148), Expect = 3e-11, Method: Compositional matrix adjust. Identities = 29/74 (39%), Positives = 44/74 (59%) Query: 14 LASVSHVSEAHFARAFKEAFGTPPHRYLLTRRIERAAALLRDSELPITEIAFRTGWRSLG 73 +A+ S +S AHF+RAFK++FG PH +L +RI A LL + +T IA G+ Sbjct: 213 IAAQSGLSRAHFSRAFKQSFGLSPHAWLQQQRIALACRLLHEGGKSMTTIALECGFSDQS 272 Query: 74 TFGRIFREITGDNP 87 F R+F+++ G P Sbjct: 273 HFSRVFKQVQGMGP 286 >gi|300311726|ref|YP_003775818.1| AraC family transcription regulator protein [Herbaspirillum seropedicae SmR1] Length = 304 Score = 58.9 bits (141), Expect = 1e-10, Method: Compositional matrix adjust. Identities = 34/88 (38%), Positives = 44/88 (50%) Query: 1 MDAASHEDWPVERLASVSHVSEAHFARAFKEAFGTPPHRYLLTRRIERAAALLRDSELPI 60 M A + W V +LA ++ +S + F F G P YLL R+E A LLR EL + Sbjct: 204 MHARIEQRWSVAQLARIAALSRSSFFERFTRTLGVAPMAYLLAWRMEIARELLRRGELSV 263 Query: 61 TEIAFRTGWRSLGTFGRIFREITGDNPG 88 +EIA RTG+ S F F G PG Sbjct: 264 SEIAERTGYGSTSAFSVAFTRQVGQPPG 291 >gi|300311694|ref|YP_003775786.1| AraC family transcription regulator protein [Herbaspirillum seropedicae SmR1] Length = 375 Score = 57.8 bits (138), Expect = 3e-10, Method: Compositional matrix adjust. Identities = 37/93 (39%), Positives = 50/93 (53%), Gaps = 6/93 (6%) Query: 20 VSEAHFARAFKEAFGTPPHRYLLTRRIERAAALLRDSELPITEIAFRTGWRSLGTFGRIF 79 +SE +F R FK G PH +L RIE A L++++LPI +IA R G S R+F Sbjct: 281 MSERNFQREFKRETGETPHCFLTKIRIEAACLYLKETDLPIEKIARRCGLVSGEHLARLF 340 Query: 80 REITGDNPGTVRKQARIAAQELSSVPACIVSAA 112 R+ G +PG RK +E + PA IVS Sbjct: 341 RKHHGVSPGEYRK------KENAPRPAPIVSVG 367 Database: BlastDatabases/689/689 Posted date: Apr 10, 2011 12:15 AM Number of letters in database: 1,619,870 Number of sequences in database: 4735 Lambda K H 0.318 0.132 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 4735 Number of Hits to DB: 456,204 Number of extensions: 17078 Number of successful extensions: 77 Number of sequences better than 1.0e-08: 6 Number of HSP's gapped: 77 Number of HSP's successfully gapped: 6 Length of query: 143 Length of database: 1,619,870 Length adjustment: 77 Effective length of query: 66 Effective length of database: 1,255,275 Effective search space: 82848150 Effective search space used: 82848150 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 126 (53.1 bits)