BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0002.0208.p (95 letters) Database: BlastDatabases/689/689 4735 sequences; 1,619,870 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|300310382|ref|YP_003774474.1| sugar ABC transporter ATPase [H... 77 3e-16 gi|300310063|ref|YP_003774155.1| sugar ABC transporter ATPase [H... 57 3e-10 gi|300313549|ref|YP_003777641.1| ABC transporter ATPase [Herbasp... 56 5e-10 gi|300310371|ref|YP_003774463.1| sugar ABC transporter ATPase [H... 55 8e-10 gi|300310367|ref|YP_003774459.1| sugar ABC transporter ATPase [H... 54 2e-09 >gi|300310382|ref|YP_003774474.1| sugar ABC transporter ATPase [Herbaspirillum seropedicae SmR1] Length = 520 Score = 77.0 bits (188), Expect = 3e-16, Method: Composition-based stats. Identities = 36/45 (80%), Positives = 40/45 (88%) Query: 35 LISLRNVTKRFPGVLALDNCQLDLLPGEVHALMGENGAGKSTLXR 79 +I+LRNV KRFPGVLALDNCQ +L GEVHALMGENGAGKSTL + Sbjct: 22 VIALRNVCKRFPGVLALDNCQFELAAGEVHALMGENGAGKSTLMK 66 >gi|300310063|ref|YP_003774155.1| sugar ABC transporter ATPase [Herbaspirillum seropedicae SmR1] Length = 521 Score = 57.0 bits (136), Expect = 3e-10, Method: Compositional matrix adjust. Identities = 25/45 (55%), Positives = 32/45 (71%) Query: 35 LISLRNVTKRFPGVLALDNCQLDLLPGEVHALMGENGAGKSTLXR 79 L+ +R + K F LAL + L + PGE+HALMGENGAGKSTL + Sbjct: 6 LLQMRGIRKSFGATLALSDMHLTIRPGEIHALMGENGAGKSTLMK 50 >gi|300313549|ref|YP_003777641.1| ABC transporter ATPase [Herbaspirillum seropedicae SmR1] Length = 518 Score = 56.2 bits (134), Expect = 5e-10, Method: Compositional matrix adjust. Identities = 24/44 (54%), Positives = 34/44 (77%) Query: 36 ISLRNVTKRFPGVLALDNCQLDLLPGEVHALMGENGAGKSTLXR 79 + + +V K +PGVLA D+ L + PGE+HA++GENGAGKSTL + Sbjct: 8 LEISHVRKAYPGVLANDDVSLAVAPGEIHAVLGENGAGKSTLMK 51 >gi|300310371|ref|YP_003774463.1| sugar ABC transporter ATPase [Herbaspirillum seropedicae SmR1] Length = 518 Score = 55.5 bits (132), Expect = 8e-10, Method: Composition-based stats. Identities = 24/45 (53%), Positives = 34/45 (75%) Query: 35 LISLRNVTKRFPGVLALDNCQLDLLPGEVHALMGENGAGKSTLXR 79 ++ +R + K FPGV AL+N L + GE+HA++GENGAGKSTL + Sbjct: 4 ILEMRGIEKSFPGVKALNNVNLAVREGEIHAIVGENGAGKSTLMK 48 >gi|300310367|ref|YP_003774459.1| sugar ABC transporter ATPase [Herbaspirillum seropedicae SmR1] Length = 516 Score = 54.3 bits (129), Expect = 2e-09, Method: Compositional matrix adjust. Identities = 25/45 (55%), Positives = 31/45 (68%) Query: 35 LISLRNVTKRFPGVLALDNCQLDLLPGEVHALMGENGAGKSTLXR 79 ++ L + K F GV AL + L L PGEVH LMG+NGAGKSTL + Sbjct: 12 MLELSGIHKAFAGVKALTDVGLRLFPGEVHTLMGQNGAGKSTLIK 56 Database: BlastDatabases/689/689 Posted date: Apr 10, 2011 12:15 AM Number of letters in database: 1,619,870 Number of sequences in database: 4735 Lambda K H 0.312 0.126 0.346 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 4735 Number of Hits to DB: 223,023 Number of extensions: 6860 Number of successful extensions: 186 Number of sequences better than 1.0e-08: 6 Number of HSP's gapped: 186 Number of HSP's successfully gapped: 6 Length of query: 95 Length of database: 1,619,870 Length adjustment: 64 Effective length of query: 31 Effective length of database: 1,316,830 Effective search space: 40821730 Effective search space used: 40821730 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 123 (52.0 bits)