BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0250.0021.p (116 letters) Database: BlastDatabases/689/689 4735 sequences; 1,619,870 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|300311171|ref|YP_003775263.1| dipeptide/oligopeptide/nickel A... 92 8e-21 gi|300312479|ref|YP_003776571.1| dipeptide/oligopeptide/nickel A... 77 3e-16 gi|300310894|ref|YP_003774986.1| dipeptide/oligopeptide/nickel A... 54 3e-09 >gi|300311171|ref|YP_003775263.1| dipeptide/oligopeptide/nickel ABC transporter permease [Herbaspirillum seropedicae SmR1] Length = 310 Score = 92.4 bits (228), Expect = 8e-21, Method: Compositional matrix adjust. Identities = 48/98 (48%), Positives = 62/98 (63%) Query: 18 GAGAFTIVRAHVLGNVLGPIFVYSTSLISVSMILASGLSFLGLGVKPPEPEWGLMLNTLR 77 GA TI+ H+ + I VY T I S+I A+GLSFLGLG + P PEWGLMLN R Sbjct: 209 GASDMTIMWKHIFPGTISAIVVYFTMRIGTSIITAAGLSFLGLGAQSPTPEWGLMLNEAR 268 Query: 78 TAIYTQPWVAALPGAFIFITSISFNMLSDGLRSAMEVK 115 + T P VA +P IF+T ++FN+L DGLR A++ K Sbjct: 269 ADMVTSPHVALVPSIAIFLTVLAFNLLGDGLRDALDPK 306 >gi|300312479|ref|YP_003776571.1| dipeptide/oligopeptide/nickel ABC transporter permease [Herbaspirillum seropedicae SmR1] Length = 305 Score = 77.0 bits (188), Expect = 3e-16, Method: Compositional matrix adjust. Identities = 38/108 (35%), Positives = 66/108 (61%), Gaps = 1/108 (0%) Query: 3 QRRRAHRAQSAGDXGGAGAFTIVRAHVLGNVLGPIFVYSTSLISVSMILASGLSFLGLGV 62 Q R A +A G + + ++R +L N++G + V T ++ +++L + LSFLGLGV Sbjct: 191 QLRDAEFIAAAKAIGASTPYILLR-EILPNIMGALIVVVTLEMAHAILLEATLSFLGLGV 249 Query: 63 KPPEPEWGLMLNTLRTAIYTQPWVAALPGAFIFITSISFNMLSDGLRS 110 +PP P WGLM+ +T ++ +PWV +PG + + ++ N++ DGLR Sbjct: 250 QPPTPSWGLMVAEGKTYMFFKPWVIVIPGVALALLVLAINLVGDGLRD 297 >gi|300310894|ref|YP_003774986.1| dipeptide/oligopeptide/nickel ABC transporter permease [Herbaspirillum seropedicae SmR1] Length = 320 Score = 53.9 bits (128), Expect = 3e-09, Method: Compositional matrix adjust. Identities = 33/114 (28%), Positives = 61/114 (53%), Gaps = 3/114 (2%) Query: 1 LGQRRRAHRAQSAGDXGGAGAFTIVRAHVLGNVLGPIFVYSTSLISVSMILASGLSFLGL 60 L +RR+ + + G ++ I+ H+L N L P+ V T ++ ++ L + LSFLGL Sbjct: 204 LVERRKEYVEAARGL--NLSSWRIMVRHILPNCLPPLIVIGTLQVARAITLEATLSFLGL 261 Query: 61 GVKPPEPEWGLML-NTLRTAIYTQPWVAALPGAFIFITSISFNMLSDGLRSAME 113 GV EP GL++ N + + + W++ PG + + ++ N++ D LR + Sbjct: 262 GVPITEPSLGLLISNGYQYMLSGEYWISFYPGITLLVVIVAINLVGDRLRDILN 315 Database: BlastDatabases/689/689 Posted date: Apr 10, 2011 12:15 AM Number of letters in database: 1,619,870 Number of sequences in database: 4735 Lambda K H 0.323 0.138 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 4735 Number of Hits to DB: 305,925 Number of extensions: 11044 Number of successful extensions: 34 Number of sequences better than 1.0e-08: 5 Number of HSP's gapped: 34 Number of HSP's successfully gapped: 5 Length of query: 116 Length of database: 1,619,870 Length adjustment: 73 Effective length of query: 43 Effective length of database: 1,274,215 Effective search space: 54791245 Effective search space used: 54791245 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 124 (52.4 bits)