BLASTP 2.2.18 [Mar-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 0249.0004.p
         (64 letters)

Database: BlastDatabases/689/689 
           4735 sequences; 1,619,870 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|300312205|ref|YP_003776297.1| nitrite reductase large subunit...   123   3e-30

>gi|300312205|ref|YP_003776297.1| nitrite reductase large subunit
           [Herbaspirillum seropedicae SmR1]
          Length = 857

 Score =  123 bits (308), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 55/64 (85%), Positives = 60/64 (93%)

Query: 1   VVDTYECEWKKAVTDPETRKRFRHFVNSKEADQNVKFVDERGQIRPATVAERKLIDIPVV 60
           VVDTYECEWKKAVTDPETRKRFRHFVNSK AD N+KFV+ERGQIRPATVAE+KL+DIPVV
Sbjct: 794 VVDTYECEWKKAVTDPETRKRFRHFVNSKAADGNIKFVEERGQIRPATVAEKKLLDIPVV 853

Query: 61  AEAI 64
            E +
Sbjct: 854 VETV 857


  Database: BlastDatabases/689/689
    Posted date:  Apr 10, 2011 12:15 AM
  Number of letters in database: 1,619,870
  Number of sequences in database:  4735
  
Lambda     K      H
   0.318    0.133    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 4735
Number of Hits to DB: 184,509
Number of extensions: 5059
Number of successful extensions: 11
Number of sequences better than 1.0e-08: 1
Number of HSP's gapped: 11
Number of HSP's successfully gapped: 1
Length of query: 64
Length of database: 1,619,870
Length adjustment: 36
Effective length of query: 28
Effective length of database: 1,449,410
Effective search space: 40583480
Effective search space used: 40583480
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 123 (52.0 bits)