BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0242.0006.p (122 letters) Database: BlastDatabases/689/689 4735 sequences; 1,619,870 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|300311006|ref|YP_003775098.1| transcription regulator protein... 97 3e-22 gi|300313266|ref|YP_003777358.1| AsnC family transcription regul... 94 3e-21 gi|300312130|ref|YP_003776222.1| glutamate uptake transcription ... 87 4e-19 gi|300309515|ref|YP_003773607.1| leucine-responsive regulatory p... 82 1e-17 gi|300312490|ref|YP_003776582.1| transcription regulator protein... 77 6e-16 >gi|300311006|ref|YP_003775098.1| transcription regulator protein [Herbaspirillum seropedicae SmR1] Length = 172 Score = 97.1 bits (240), Expect = 3e-22, Method: Compositional matrix adjust. Identities = 46/122 (37%), Positives = 74/122 (60%) Query: 1 MSASPCWRRQKELEDNGYIVRYTAVVDRRKLGLSVCCLAHISLLRHAEGVVEKFEEAMRM 60 +S S RR + LE+ I RYTAV+D +GL V ++L R E E FE+A+ Sbjct: 34 LSTSQISRRVQRLEEAHVIERYTAVLDPAVVGLGVTAFTTVTLDRQGETRGELFEKAVET 93 Query: 61 RPEVVECYETTGTADYMVKVIVPDMEAYHDFLHNVLVKLNGVSQVNTSVALREVKYETAL 120 PEV EC+ TG DY+++++ PD+ A+ +F+ L++L GV+ V +++ L++VK L Sbjct: 94 MPEVTECFSVTGEGDYILRIVAPDLAAFSEFMMTRLLRLPGVTNVKSNITLKKVKQSHEL 153 Query: 121 PI 122 P+ Sbjct: 154 PL 155 >gi|300313266|ref|YP_003777358.1| AsnC family transcription regulator protein [Herbaspirillum seropedicae SmR1] Length = 159 Score = 94.0 bits (232), Expect = 3e-21, Method: Compositional matrix adjust. Identities = 46/121 (38%), Positives = 69/121 (57%) Query: 1 MSASPCWRRQKELEDNGYIVRYTAVVDRRKLGLSVCCLAHISLLRHAEGVVEKFEEAMRM 60 +S SP R K LE G I RY A+ D LGL V + L R + +FE A+ Sbjct: 31 LSPSPTLARVKRLESEGIISRYVALADPHLLGLKVNVFVKVILERQGAEALAQFETAVSA 90 Query: 61 RPEVVECYETTGTADYMVKVIVPDMEAYHDFLHNVLVKLNGVSQVNTSVALREVKYETAL 120 EV+E Y TG DY+++++VPD+ F+ + L K+ G+ + +S AL+++KY+TAL Sbjct: 91 FDEVMEVYLMTGDEDYLLRIVVPDLLTLEHFIVDHLTKIPGIKNIRSSFALKQIKYKTAL 150 Query: 121 P 121 P Sbjct: 151 P 151 >gi|300312130|ref|YP_003776222.1| glutamate uptake transcription regulator protein [Herbaspirillum seropedicae SmR1] Length = 154 Score = 87.0 bits (214), Expect = 4e-19, Method: Compositional matrix adjust. Identities = 45/122 (36%), Positives = 73/122 (59%), Gaps = 1/122 (0%) Query: 1 MSASPCWRRQKELEDNGYIVRYTAVVDRRKLGLSVCCLAHISLLRHAEGVVEKFEEAMRM 60 +S +PCWRR + LE G I R ++D KL +SV L I +H+ ++KF + + Sbjct: 30 LSTTPCWRRIQRLEAEGVIKRRVVLLDAEKLNVSVTVLVEIKTRQHSASWLKKFRDVVTC 89 Query: 61 RPEVVECYETTGTADYMVKVIVPDMEAYHDFLHNVLVKLNGVSQVNTSVALREVKYETAL 120 PEVVE + +G DYM+KV+VP++ AY D ++ L+ + V++S ++ +K TAL Sbjct: 90 IPEVVEVHRMSGHIDYMLKVMVPNIGAY-DSVYKRLISAVELDDVSSSFSMETLKSTTAL 148 Query: 121 PI 122 P+ Sbjct: 149 PL 150 >gi|300309515|ref|YP_003773607.1| leucine-responsive regulatory protein [Herbaspirillum seropedicae SmR1] Length = 154 Score = 82.0 bits (201), Expect = 1e-17, Method: Compositional matrix adjust. Identities = 42/122 (34%), Positives = 70/122 (57%) Query: 1 MSASPCWRRQKELEDNGYIVRYTAVVDRRKLGLSVCCLAHISLLRHAEGVVEKFEEAMRM 60 +S + C R ++L++ GYI+ Y A ++ L +S+ + L R V +F+++++ Sbjct: 32 LSPAACLERVRKLQEAGYILGYAAQLNPELLDVSLLVFIEVVLDRTTPDVFAEFKKSVQS 91 Query: 61 RPEVVECYETTGTADYMVKVIVPDMEAYHDFLHNVLVKLNGVSQVNTSVALREVKYETAL 120 PE++EC+ G DY+VK V DM AY +FL L++L GV + +T + EVK L Sbjct: 92 IPEIMECHMVAGGFDYLVKSRVKDMNAYREFLGKSLLQLKGVRETHTYAVMEEVKNTIRL 151 Query: 121 PI 122 PI Sbjct: 152 PI 153 >gi|300312490|ref|YP_003776582.1| transcription regulator protein [Herbaspirillum seropedicae SmR1] Length = 153 Score = 76.6 bits (187), Expect = 6e-16, Method: Compositional matrix adjust. Identities = 43/120 (35%), Positives = 62/120 (51%) Query: 1 MSASPCWRRQKELEDNGYIVRYTAVVDRRKLGLSVCCLAHISLLRHAEGVVEKFEEAMRM 60 MSA+ CW K L + GY+ A++D KLGL V + L R +FE+A+R Sbjct: 31 MSATACWNHTKRLMEEGYVKEVRAILDPEKLGLPVLVTVGVVLDRSTPESFAEFEKAVRD 90 Query: 61 RPEVVECYETTGTADYMVKVIVPDMEAYHDFLHNVLVKLNGVSQVNTSVALREVKYETAL 120 V EC G DY +K+ V D++A++ N L++L GV Q+ + L EVK L Sbjct: 91 IAAVQECLLLAGEFDYWIKLRVKDLQAFNRLHANTLLRLPGVRQLRSFFVLNEVKNNPEL 150 Database: BlastDatabases/689/689 Posted date: Apr 10, 2011 12:15 AM Number of letters in database: 1,619,870 Number of sequences in database: 4735 Lambda K H 0.322 0.135 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 4735 Number of Hits to DB: 341,400 Number of extensions: 11595 Number of successful extensions: 41 Number of sequences better than 1.0e-08: 9 Number of HSP's gapped: 41 Number of HSP's successfully gapped: 9 Length of query: 122 Length of database: 1,619,870 Length adjustment: 74 Effective length of query: 48 Effective length of database: 1,269,480 Effective search space: 60935040 Effective search space used: 60935040 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 125 (52.8 bits)