BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0242.0004.p (108 letters) Database: BlastDatabases/689/689 4735 sequences; 1,619,870 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|300313404|ref|YP_003777496.1| branched-chain amino acid ABC t... 76 5e-16 gi|300313301|ref|YP_003777393.1| branched-chain amino acid ABC t... 70 4e-14 gi|300310684|ref|YP_003774776.1| amino acid ABC transporter ATPa... 64 2e-12 gi|300311116|ref|YP_003775208.1| branched-chain amino acid ABC t... 62 1e-11 gi|300310995|ref|YP_003775087.1| branched-chain amino acid ABC t... 55 1e-09 >gi|300313404|ref|YP_003777496.1| branched-chain amino acid ABC transporter ATPase [Herbaspirillum seropedicae SmR1] Length = 269 Score = 76.3 bits (186), Expect = 5e-16, Method: Compositional matrix adjust. Identities = 39/51 (76%), Positives = 42/51 (82%) Query: 15 VLLDVSNLHARYGKVEALHGAGLQVRAGQIVTVIGPNGAGKSTLLNAIMXA 65 VLL+VS L ARYGKV AL L +RAGQIVTVIGPNGAGKSTLLNA+M A Sbjct: 24 VLLEVSGLSARYGKVAALTDTALSLRAGQIVTVIGPNGAGKSTLLNAMMGA 74 Score = 59.3 bits (142), Expect = 6e-11, Method: Compositional matrix adjust. Identities = 29/40 (72%), Positives = 32/40 (80%) Query: 65 ARAALQVADYAYVLEMGEPVMEGPASELAANKQIIESYLG 104 ARAALQVADY YVLEMGE V GPA LA + +I+ESYLG Sbjct: 223 ARAALQVADYGYVLEMGEIVCAGPAGVLAEDSRIVESYLG 262 >gi|300313301|ref|YP_003777393.1| branched-chain amino acid ABC transporter ATPase [Herbaspirillum seropedicae SmR1] Length = 251 Score = 70.1 bits (170), Expect = 4e-14, Method: Compositional matrix adjust. Identities = 34/50 (68%), Positives = 40/50 (80%) Query: 14 EVLLDVSNLHARYGKVEALHGAGLQVRAGQIVTVIGPNGAGKSTLLNAIM 63 E++LDV+ L A YGKV+ALH L++ G I TVIGPNGAGKSTLLNAIM Sbjct: 3 ELVLDVAQLRASYGKVQALHDIHLKLERGSIATVIGPNGAGKSTLLNAIM 52 Score = 57.4 bits (137), Expect = 3e-10, Method: Compositional matrix adjust. Identities = 24/44 (54%), Positives = 35/44 (79%) Query: 65 ARAALQVADYAYVLEMGEPVMEGPASELAANKQIIESYLGFAKH 108 ARAALQ ADY YVLE+G+ ++G +++LA + Q+I++YLGF K Sbjct: 199 ARAALQTADYGYVLELGKVTLQGESAQLAGDPQVIQAYLGFGKK 242 >gi|300310684|ref|YP_003774776.1| amino acid ABC transporter ATPase [Herbaspirillum seropedicae SmR1] Length = 249 Score = 64.3 bits (155), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 33/51 (64%), Positives = 39/51 (76%) Query: 13 GEVLLDVSNLHARYGKVEALHGAGLQVRAGQIVTVIGPNGAGKSTLLNAIM 63 G +L+V +L A YGKVE L G L V G+IVTVIGPNGAGK+TLL+AIM Sbjct: 2 GNKVLEVRDLSAAYGKVEVLAGIDLSVEQGKIVTVIGPNGAGKTTLLSAIM 52 Score = 57.8 bits (138), Expect = 2e-10, Method: Compositional matrix adjust. Identities = 29/45 (64%), Positives = 36/45 (80%), Gaps = 1/45 (2%) Query: 65 ARAALQVADYAYVLEMGEPVMEGPASELAANKQIIESYLGFA-KH 108 ARAALQVADY YVLE G M GPAS+LA ++++IE+YLG + KH Sbjct: 199 ARAALQVADYGYVLENGAIRMHGPASQLAHDRRVIEAYLGLSGKH 243 >gi|300311116|ref|YP_003775208.1| branched-chain amino acid ABC transporter ATPase [Herbaspirillum seropedicae SmR1] Length = 242 Score = 62.0 bits (149), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 28/47 (59%), Positives = 37/47 (78%) Query: 16 LLDVSNLHARYGKVEALHGAGLQVRAGQIVTVIGPNGAGKSTLLNAI 62 +L +SNLHA YGKVE LHG ++V G++VT+IG NGAGK+T + AI Sbjct: 1 MLTISNLHAAYGKVEVLHGISMEVPKGKVVTLIGSNGAGKTTTMRAI 47 >gi|300310995|ref|YP_003775087.1| branched-chain amino acid ABC transporter ATPase [Herbaspirillum seropedicae SmR1] Length = 235 Score = 55.5 bits (132), Expect = 1e-09, Method: Compositional matrix adjust. Identities = 25/45 (55%), Positives = 32/45 (71%) Query: 15 VLLDVSNLHARYGKVEALHGAGLQVRAGQIVTVIGPNGAGKSTLL 59 ++L +H YG +EALHG L V G+IVT+IG NGAGK+TLL Sbjct: 1 MMLQFDKVHTHYGAIEALHGVSLNVEKGEIVTLIGANGAGKTTLL 45 Database: BlastDatabases/689/689 Posted date: Apr 10, 2011 12:15 AM Number of letters in database: 1,619,870 Number of sequences in database: 4735 Lambda K H 0.314 0.131 0.358 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 4735 Number of Hits to DB: 316,059 Number of extensions: 11587 Number of successful extensions: 269 Number of sequences better than 1.0e-08: 11 Number of HSP's gapped: 272 Number of HSP's successfully gapped: 14 Length of query: 108 Length of database: 1,619,870 Length adjustment: 72 Effective length of query: 36 Effective length of database: 1,278,950 Effective search space: 46042200 Effective search space used: 46042200 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 124 (52.4 bits)