BLASTP 2.2.18 [Mar-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 0234.0023.p
         (100 letters)

Database: BlastDatabases/689/689 
           4735 sequences; 1,619,870 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|300312656|ref|YP_003776748.1| alpha-ketoglutarate permease of...   108   1e-25

>gi|300312656|ref|YP_003776748.1| alpha-ketoglutarate permease of
          the major facilitator superfamily protein
          [Herbaspirillum seropedicae SmR1]
          Length = 457

 Score =  108 bits (269), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 49/52 (94%), Positives = 51/52 (98%)

Query: 26 RQRIFAILGASSGNLVEWFDFYVYSFCAIYFAPAFFPKGDTTTQLLNTAGVF 77
          R+RIFAILGASSGNLVEWFDFYVYSFCAIYFAPAFFPKGD T+QLLNTAGVF
Sbjct: 17 RKRIFAILGASSGNLVEWFDFYVYSFCAIYFAPAFFPKGDPTSQLLNTAGVF 68


  Database: BlastDatabases/689/689
    Posted date:  Apr 10, 2011 12:15 AM
  Number of letters in database: 1,619,870
  Number of sequences in database:  4735
  
Lambda     K      H
   0.324    0.131    0.443 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 4735
Number of Hits to DB: 232,033
Number of extensions: 7388
Number of successful extensions: 32
Number of sequences better than 1.0e-08: 1
Number of HSP's gapped: 32
Number of HSP's successfully gapped: 1
Length of query: 100
Length of database: 1,619,870
Length adjustment: 69
Effective length of query: 31
Effective length of database: 1,293,155
Effective search space: 40087805
Effective search space used: 40087805
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 123 (52.0 bits)