BLASTP 2.2.18 [Mar-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 0216.0020.p
         (88 letters)

Database: BlastDatabases/689/689 
           4735 sequences; 1,619,870 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|300309642|ref|YP_003773734.1| aldo/keto reductase [Herbaspiri...    57   3e-10

>gi|300309642|ref|YP_003773734.1| aldo/keto reductase
           [Herbaspirillum seropedicae SmR1]
          Length = 280

 Score = 57.0 bits (136), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 28/69 (40%), Positives = 45/69 (65%), Gaps = 1/69 (1%)

Query: 2   PLAYGKVMTDPTLIGIAKAHQANPAQIALAWSLQQ-GFATIPSSTKRANLESNLAAQKIV 60
           P+  G+++  P L  +A+AH+  PAQIALAW L+Q G   IP +   A++++N A+  I 
Sbjct: 196 PIEQGRILKHPALTALAQAHRVTPAQIALAWVLRQPGVVAIPKAADVAHVQANRASLDIS 255

Query: 61  LSDADMQAI 69
           LS AD++ +
Sbjct: 256 LSAADLKIL 264


  Database: BlastDatabases/689/689
    Posted date:  Apr 10, 2011 12:15 AM
  Number of letters in database: 1,619,870
  Number of sequences in database:  4735
  
Lambda     K      H
   0.315    0.127    0.370 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 4735
Number of Hits to DB: 289,054
Number of extensions: 9252
Number of successful extensions: 31
Number of sequences better than 1.0e-08: 1
Number of HSP's gapped: 32
Number of HSP's successfully gapped: 1
Length of query: 88
Length of database: 1,619,870
Length adjustment: 58
Effective length of query: 30
Effective length of database: 1,345,240
Effective search space: 40357200
Effective search space used: 40357200
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 123 (52.0 bits)