BLASTP 2.2.18 [Mar-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 0216.0014.p
         (61 letters)

Database: BlastDatabases/689/689 
           4735 sequences; 1,619,870 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|300309897|ref|YP_003773989.1| transcription regulator protein...    59   6e-11

>gi|300309897|ref|YP_003773989.1| transcription regulator protein
          [Herbaspirillum seropedicae SmR1]
          Length = 148

 Score = 59.3 bits (142), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 38/51 (74%)

Query: 10 QCPVARTLERVGEWWSILILRDALHGLTRFDQFQKSLDIAPNMLTRRLQTL 60
           CPVAR+++ VG+ W++LI+RDA  G+ RF  FQ++L ++ N+L  RL+ L
Sbjct: 11 HCPVARSVDVVGDRWALLIVRDAFDGIRRFGDFQRNLSVSKNILADRLRKL 61


  Database: BlastDatabases/689/689
    Posted date:  Apr 10, 2011 12:15 AM
  Number of letters in database: 1,619,870
  Number of sequences in database:  4735
  
Lambda     K      H
   0.328    0.138    0.437 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 4735
Number of Hits to DB: 176,351
Number of extensions: 5083
Number of successful extensions: 15
Number of sequences better than 1.0e-08: 1
Number of HSP's gapped: 15
Number of HSP's successfully gapped: 1
Length of query: 61
Length of database: 1,619,870
Length adjustment: 33
Effective length of query: 28
Effective length of database: 1,463,615
Effective search space: 40981220
Effective search space used: 40981220
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 123 (52.0 bits)