BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0211.0003.p (62 letters) Database: BlastDatabases/689/689 4735 sequences; 1,619,870 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|300312237|ref|YP_003776329.1| amino acid ABC transporter perm... 105 1e-24 gi|300310992|ref|YP_003775084.1| branched-chain aminoacid ABC tr... 65 1e-12 gi|300310521|ref|YP_003774613.1| branched-chain amino acid ABC t... 58 1e-10 gi|300309519|ref|YP_003773611.1| branched-chain amino acid ABC t... 58 1e-10 >gi|300312237|ref|YP_003776329.1| amino acid ABC transporter permease [Herbaspirillum seropedicae SmR1] Length = 293 Score = 105 bits (261), Expect = 1e-24, Method: Compositional matrix adjust. Identities = 55/56 (98%), Positives = 56/56 (100%) Query: 1 MLEQQLINALSLGSVYALFALGFTLVFGVLGVINLSHGAIFMLGSYAALLLVEKMA 56 MLEQQLINALSLGSVYALFALGFTLVFGVLGVINLSHGAIFMLGSYAALLLVE+MA Sbjct: 1 MLEQQLINALSLGSVYALFALGFTLVFGVLGVINLSHGAIFMLGSYAALLLVEQMA 56 >gi|300310992|ref|YP_003775084.1| branched-chain aminoacid ABC transporter permease [Herbaspirillum seropedicae SmR1] Length = 308 Score = 65.1 bits (157), Expect = 1e-12, Method: Compositional matrix adjust. Identities = 27/49 (55%), Positives = 41/49 (83%) Query: 2 LEQQLINALSLGSVYALFALGFTLVFGVLGVINLSHGAIFMLGSYAALL 50 L QQL+N LSLG++YAL A+G+T+V+G++G+IN +HG I+M+ SY L+ Sbjct: 8 LTQQLVNGLSLGAIYALIAIGYTMVYGIIGMINFAHGEIYMIASYVGLV 56 >gi|300310521|ref|YP_003774613.1| branched-chain amino acid ABC transporter permease [Herbaspirillum seropedicae SmR1] Length = 309 Score = 58.2 bits (139), Expect = 1e-10, Method: Compositional matrix adjust. Identities = 28/50 (56%), Positives = 39/50 (78%) Query: 4 QQLINALSLGSVYALFALGFTLVFGVLGVINLSHGAIFMLGSYAALLLVE 53 QQ+IN L LGS+YAL ALG+T+V+GVL +IN +HG I M+G+ L L++ Sbjct: 6 QQIINGLVLGSMYALIALGYTMVYGVLNLINFAHGDILMVGAMVGLSLLK 55 >gi|300309519|ref|YP_003773611.1| branched-chain amino acid ABC transporter permease [Herbaspirillum seropedicae SmR1] Length = 309 Score = 58.2 bits (139), Expect = 1e-10, Method: Compositional matrix adjust. Identities = 28/50 (56%), Positives = 39/50 (78%) Query: 4 QQLINALSLGSVYALFALGFTLVFGVLGVINLSHGAIFMLGSYAALLLVE 53 QQ+IN L LGS+YAL ALG+T+V+GVL +IN +HG I M+G+ L L++ Sbjct: 6 QQIINGLVLGSMYALIALGYTMVYGVLNLINFAHGDILMVGAMVGLSLLK 55 Database: BlastDatabases/689/689 Posted date: Apr 10, 2011 12:15 AM Number of letters in database: 1,619,870 Number of sequences in database: 4735 Lambda K H 0.333 0.147 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 4735 Number of Hits to DB: 181,689 Number of extensions: 5787 Number of successful extensions: 61 Number of sequences better than 1.0e-08: 5 Number of HSP's gapped: 61 Number of HSP's successfully gapped: 5 Length of query: 62 Length of database: 1,619,870 Length adjustment: 34 Effective length of query: 28 Effective length of database: 1,458,880 Effective search space: 40848640 Effective search space used: 40848640 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (22.0 bits) S2: 123 (52.0 bits)