BLASTP 2.2.18 [Mar-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 0204.0009.p
         (63 letters)

Database: BlastDatabases/689/689 
           4735 sequences; 1,619,870 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|300311234|ref|YP_003775326.1| hypothetical protein Hsero_1909...    70   4e-14

>gi|300311234|ref|YP_003775326.1| hypothetical protein Hsero_1909
           [Herbaspirillum seropedicae SmR1]
          Length = 257

 Score = 69.7 bits (169), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 36/64 (56%), Positives = 45/64 (70%), Gaps = 4/64 (6%)

Query: 2   PYWMLA--TAKG--GIRLPNDTPGLESLMEEFKVKLPGYDNDATYAAVIAAMGAMEGVFE 57
           P W+L+  +A+G  GI +PND  GLE LM+  K +LPGYDND  Y+ VIAAM AMEG F 
Sbjct: 191 PEWILSGQSAEGIKGILVPNDADGLEELMQAMKQRLPGYDNDQNYSTVIAAMSAMEGSFH 250

Query: 58  VWKK 61
           VW +
Sbjct: 251 VWSR 254


  Database: BlastDatabases/689/689
    Posted date:  Apr 10, 2011 12:15 AM
  Number of letters in database: 1,619,870
  Number of sequences in database:  4735
  
Lambda     K      H
   0.317    0.133    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 4735
Number of Hits to DB: 221,693
Number of extensions: 6834
Number of successful extensions: 24
Number of sequences better than 1.0e-08: 1
Number of HSP's gapped: 24
Number of HSP's successfully gapped: 1
Length of query: 63
Length of database: 1,619,870
Length adjustment: 35
Effective length of query: 28
Effective length of database: 1,454,145
Effective search space: 40716060
Effective search space used: 40716060
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 123 (52.0 bits)