BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0194.0008.p (200 letters) Database: BlastDatabases/689/689 4735 sequences; 1,619,870 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|300311442|ref|YP_003775534.1| acyl-carrier-protein phosphodie... 90 1e-19 gi|300313224|ref|YP_003777316.1| [acyl-carrier-protein] phosphod... 78 5e-16 gi|300313768|ref|YP_003777860.1| acyl carrier protein phosphodie... 69 2e-13 >gi|300311442|ref|YP_003775534.1| acyl-carrier-protein phosphodiesterase [Herbaspirillum seropedicae SmR1] Length = 202 Score = 89.7 bits (221), Expect = 1e-19, Method: Compositional matrix adjust. Identities = 48/119 (40%), Positives = 72/119 (60%), Gaps = 2/119 (1%) Query: 3 LLHVDASAKREWSNSRALSRHFIDLLRQQVPALDVDYLDVAADANPPAHVSEAFTVATYT 62 LLH+D+SA+ S SR L+ F+ + + P V + D+AA+A P H+SE+ A +T Sbjct: 4 LLHIDSSARSGGSISRQLTASFVSQWQAKNPGGKVVHRDLAANALP--HLSESMLGAYFT 61 Query: 63 PAAQRTPAMKQTLEASDALCKRVLEADAFVFAMPMYNFSMPSVFKAFIDNIVRTDLTYK 121 PA R+ + ++ SDAL +L AD V +PMYNF+ PS KA+ID++ R T+K Sbjct: 62 PADARSAEQAEVIKQSDALVDELLAADTIVIGVPMYNFAPPSTLKAWIDHVFRAGRTFK 120 >gi|300313224|ref|YP_003777316.1| [acyl-carrier-protein] phosphodiesterase [Herbaspirillum seropedicae SmR1] Length = 203 Score = 77.8 bits (190), Expect = 5e-16, Method: Compositional matrix adjust. Identities = 50/120 (41%), Positives = 65/120 (54%), Gaps = 3/120 (2%) Query: 1 MKLLHVDASAKREWSNSRALSRHFIDLLRQQVPALDVDYLDVAADANPPAHVSEAFTVAT 60 MKLLH+D S E S SR LS + LR P L+V Y D+AA A P H+S A +A Sbjct: 1 MKLLHLDTSILGEHSVSRQLSADIVAHLRSLQPDLEVIYRDLAAAA--PRHLS-AEHLAA 57 Query: 61 YTPAAQRTPAMKQTLEASDALCKRVLEADAFVFAMPMYNFSMPSVFKAFIDNIVRTDLTY 120 + A PA++ L A +L+AD V PMYNFS+PS KA+ID + T+ Sbjct: 58 FGGAEVDDPALRADLALGQACLDELLQADLLVIGAPMYNFSLPSQLKAWIDRVAVAGTTF 117 >gi|300313768|ref|YP_003777860.1| acyl carrier protein phosphodiesterase [Herbaspirillum seropedicae SmR1] Length = 208 Score = 68.9 bits (167), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 42/122 (34%), Positives = 63/122 (51%), Gaps = 3/122 (2%) Query: 1 MKLLHVDASAKREWSNSRALSRHFIDLLRQQVPALDVDYLDVAADANPPAHVSEAFTVAT 60 MK+LH+D+S E S SR LS ++ LR P V D+AA P AH+ Sbjct: 1 MKILHLDSSILAEASASRVLSAAVVEELRILHPTAQVSVRDLAA--APIAHLDGPIAAGF 58 Query: 61 YTPAAQR-TPAMKQTLEASDALCKRVLEADAFVFAMPMYNFSMPSVFKAFIDNIVRTDLT 119 P A +P ++ S+ L + L +D V +PMYNFS+PS KA++D + + T Sbjct: 59 RQPGANHASPEVRAEQALSETLVSQFLNSDVIVLGVPMYNFSIPSQLKAWLDRVAQPGRT 118 Query: 120 YK 121 ++ Sbjct: 119 FR 120 Database: BlastDatabases/689/689 Posted date: Apr 10, 2011 12:15 AM Number of letters in database: 1,619,870 Number of sequences in database: 4735 Lambda K H 0.322 0.131 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 4735 Number of Hits to DB: 544,304 Number of extensions: 18274 Number of successful extensions: 71 Number of sequences better than 1.0e-08: 3 Number of HSP's gapped: 69 Number of HSP's successfully gapped: 3 Length of query: 200 Length of database: 1,619,870 Length adjustment: 81 Effective length of query: 119 Effective length of database: 1,236,335 Effective search space: 147123865 Effective search space used: 147123865 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 128 (53.9 bits)