BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0180.0026.p (70 letters) Database: BlastDatabases/689/689 4735 sequences; 1,619,870 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|300312356|ref|YP_003776448.1| cobalt/zinc/cadmium resistance ... 129 4e-32 gi|300309361|ref|YP_003773453.1| response regulator for cobalt/z... 88 1e-19 gi|300311799|ref|YP_003775891.1| two component heavy metal respo... 86 7e-19 gi|300313896|ref|YP_003777988.1| two component transcription res... 59 7e-11 gi|300312688|ref|YP_003776780.1| response regulator consisting o... 55 1e-09 >gi|300312356|ref|YP_003776448.1| cobalt/zinc/cadmium resistance two component response regulator protein [Herbaspirillum seropedicae SmR1] Length = 223 Score = 129 bits (324), Expect = 4e-32, Method: Compositional matrix adjust. Identities = 61/70 (87%), Positives = 65/70 (92%) Query: 1 MAILVIEDDPKTGDYLKKGLRESGYTVDLARTGTDGLHMAMEQNYDLVVLDVMLPGTDGW 60 MAILVIEDDPKTGDYL+KGLRESGY VDLAR G DGLHMA+EQ+YDLVVLDVMLPG DGW Sbjct: 1 MAILVIEDDPKTGDYLRKGLRESGYAVDLARNGADGLHMALEQDYDLVVLDVMLPGLDGW 60 Query: 61 QVMSALRAGR 70 QVMSALR+ R Sbjct: 61 QVMSALRSKR 70 >gi|300309361|ref|YP_003773453.1| response regulator for cobalt/zinc/cadmium resistance transcription regulator protein [Herbaspirillum seropedicae SmR1] Length = 235 Score = 88.2 bits (217), Expect = 1e-19, Method: Compositional matrix adjust. Identities = 38/67 (56%), Positives = 52/67 (77%) Query: 1 MAILVIEDDPKTGDYLKKGLRESGYTVDLARTGTDGLHMAMEQNYDLVVLDVMLPGTDGW 60 M IL++ED+PK+GDYL++GL ESG+ VD +TG DGLH A +Y L++LDVMLPG +GW Sbjct: 1 MHILLVEDEPKSGDYLRRGLTESGFVVDWVQTGVDGLHNARTLDYKLIILDVMLPGMNGW 60 Query: 61 QVMSALR 67 ++ LR Sbjct: 61 DILRELR 67 >gi|300311799|ref|YP_003775891.1| two component heavy metal response transcription regulator protein [Herbaspirillum seropedicae SmR1] Length = 230 Score = 85.5 bits (210), Expect = 7e-19, Method: Compositional matrix adjust. Identities = 39/67 (58%), Positives = 50/67 (74%) Query: 1 MAILVIEDDPKTGDYLKKGLRESGYTVDLARTGTDGLHMAMEQNYDLVVLDVMLPGTDGW 60 M IL++ED+ K +YL KGL E G VDLA G DG H+A+E +YD++VLDVMLPG DG+ Sbjct: 1 MKILIVEDEQKMSEYLCKGLTEQGCAVDLAANGVDGQHLAIEHDYDVIVLDVMLPGLDGF 60 Query: 61 QVMSALR 67 V+ ALR Sbjct: 61 SVLRALR 67 >gi|300313896|ref|YP_003777988.1| two component transcription response regulator protein [Herbaspirillum seropedicae SmR1] Length = 244 Score = 58.9 bits (141), Expect = 7e-11, Method: Compositional matrix adjust. Identities = 27/65 (41%), Positives = 39/65 (60%) Query: 3 ILVIEDDPKTGDYLKKGLRESGYTVDLARTGTDGLHMAMEQNYDLVVLDVMLPGTDGWQV 62 IL++ED+PK + L+K L +GY+ G L Q DL++LD+MLPG DGW++ Sbjct: 18 ILIVEDEPKLAELLQKYLALAGYSARHVARGDAALDAVRAQRPDLILLDIMLPGMDGWEI 77 Query: 63 MSALR 67 LR Sbjct: 78 CRQLR 82 >gi|300312688|ref|YP_003776780.1| response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain-containing protein [Herbaspirillum seropedicae SmR1] Length = 222 Score = 55.1 bits (131), Expect = 1e-09, Method: Compositional matrix adjust. Identities = 26/67 (38%), Positives = 43/67 (64%) Query: 1 MAILVIEDDPKTGDYLKKGLRESGYTVDLARTGTDGLHMAMEQNYDLVVLDVMLPGTDGW 60 M +L+IED+P+ +L++ L+E + VD+A G + ++NYD+V+LD+MLP G Sbjct: 1 MKLLLIEDNPQLAHWLEQILKEHKFKVDIAADGEIADQVLRDENYDVVLLDLMLPKLHGK 60 Query: 61 QVMSALR 67 V+ LR Sbjct: 61 NVLRRLR 67 Database: BlastDatabases/689/689 Posted date: Apr 10, 2011 12:15 AM Number of letters in database: 1,619,870 Number of sequences in database: 4735 Lambda K H 0.318 0.138 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 4735 Number of Hits to DB: 242,455 Number of extensions: 8624 Number of successful extensions: 110 Number of sequences better than 1.0e-08: 10 Number of HSP's gapped: 114 Number of HSP's successfully gapped: 10 Length of query: 70 Length of database: 1,619,870 Length adjustment: 42 Effective length of query: 28 Effective length of database: 1,421,000 Effective search space: 39788000 Effective search space used: 39788000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 123 (52.0 bits)