BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0178.0047.p (125 letters) Database: BlastDatabases/689/689 4735 sequences; 1,619,870 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|300309958|ref|YP_003774050.1| methyl-accepting chemotaxis tra... 152 8e-39 gi|300313312|ref|YP_003777404.1| methyl-accepting chemotaxis pro... 64 3e-12 gi|300309735|ref|YP_003773827.1| methyl-accepting chemotaxis sen... 62 1e-11 gi|300310428|ref|YP_003774520.1| methyl-accepting chemotaxis tra... 61 2e-11 gi|300312336|ref|YP_003776428.1| methyl-accepting chemotaxis tra... 56 8e-10 >gi|300309958|ref|YP_003774050.1| methyl-accepting chemotaxis transducer transmembrane protein [Herbaspirillum seropedicae SmR1] Length = 595 Score = 152 bits (384), Expect = 8e-39, Method: Compositional matrix adjust. Identities = 86/127 (67%), Positives = 97/127 (76%), Gaps = 7/127 (5%) Query: 1 MVPSIRKTADLVQEISAASREQSAGLEQINNAVHQMAQTTQLTASASEELSSTSEEMSAQ 60 MVPSIRKTADLVQEI+AAS EQS GLEQINNAVHQMAQTTQ+TASASEELS+TSEEMSAQ Sbjct: 474 MVPSIRKTADLVQEIAAASHEQSTGLEQINNAVHQMAQTTQMTASASEELSATSEEMSAQ 533 Query: 61 AIQLQELILFFQVGEEKRPQSKKAAKPGKMINEPPIISTKFVKPARISMLDGGDD--PID 118 AI LQ+L+ FFQVGE + K A + K + PP K R+SMLD +D +D Sbjct: 534 AIHLQDLMRFFQVGEPR----KNAPRASKAVPLPP-SGGKSDSVRRLSMLDAPEDERGVD 588 Query: 119 ESSFKRF 125 ESSFKRF Sbjct: 589 ESSFKRF 595 >gi|300313312|ref|YP_003777404.1| methyl-accepting chemotaxis protein I [Herbaspirillum seropedicae SmR1] Length = 544 Score = 64.3 bits (155), Expect = 3e-12, Method: Compositional matrix adjust. Identities = 33/76 (43%), Positives = 52/76 (68%) Query: 1 MVPSIRKTADLVQEISAASREQSAGLEQINNAVHQMAQTTQLTASASEELSSTSEEMSAQ 60 +V S+R+ D+V EISAASREQS G+EQ+N A+ M Q+TQ A+ EE ++ ++ + Q Sbjct: 438 VVESVRRVTDVVTEISAASREQSLGIEQVNQAISHMDQSTQENAALVEEATAAAQSLQEQ 497 Query: 61 AIQLQELILFFQVGEE 76 A QL+ + F++ +E Sbjct: 498 ARQLERAVNVFKLRQE 513 >gi|300309735|ref|YP_003773827.1| methyl-accepting chemotaxis sensory transducer protein [Herbaspirillum seropedicae SmR1] Length = 567 Score = 62.0 bits (149), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 34/80 (42%), Positives = 53/80 (66%) Query: 1 MVPSIRKTADLVQEISAASREQSAGLEQINNAVHQMAQTTQLTASASEELSSTSEEMSAQ 60 +V S+++ D++ EISAAS EQ+ G+EQ+N A+ QM + TQ A+ EE +S S+ +S Q Sbjct: 443 VVSSVQRVTDVMSEISAASGEQTQGIEQVNQAITQMDEVTQQNAALVEEAASASQSLSHQ 502 Query: 61 AIQLQELILFFQVGEEKRPQ 80 A +L EL+ F++ R Q Sbjct: 503 AQRLSELVGVFRLPGAARQQ 522 >gi|300310428|ref|YP_003774520.1| methyl-accepting chemotaxis transducer transmembrane protein [Herbaspirillum seropedicae SmR1] Length = 517 Score = 61.2 bits (147), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 35/84 (41%), Positives = 55/84 (65%) Query: 1 MVPSIRKTADLVQEISAASREQSAGLEQINNAVHQMAQTTQLTASASEELSSTSEEMSAQ 60 MVP+I +T+ LVQ+I +S +QS + QI+ A Q+AQ Q + +SEEL+ TSEE++ + Sbjct: 434 MVPTITRTSVLVQDIVQSSEQQSTAVSQISTAASQLAQVIQQNSLSSEELAVTSEELNRR 493 Query: 61 AIQLQELILFFQVGEEKRPQSKKA 84 A+ LQ + FFQ + Q++ A Sbjct: 494 ALLLQTAVGFFQCQLARGMQARLA 517 >gi|300312336|ref|YP_003776428.1| methyl-accepting chemotaxis transducer transmembrane protein [Herbaspirillum seropedicae SmR1] Length = 536 Score = 56.2 bits (134), Expect = 8e-10, Method: Compositional matrix adjust. Identities = 33/75 (44%), Positives = 50/75 (66%) Query: 1 MVPSIRKTADLVQEISAASREQSAGLEQINNAVHQMAQTTQLTASASEELSSTSEEMSAQ 60 +V S+R+ D+V EISAAS EQ+ G+EQIN A+ QM Q TQ A+ EE ++ + M Q Sbjct: 442 VVSSVRRVTDIVAEISAASTEQTHGIEQINLAITQMDQVTQQNAALVEEAAAAAASMQTQ 501 Query: 61 AIQLQELILFFQVGE 75 A +L +++ F++ E Sbjct: 502 AGRLMQMVSVFRLSE 516 Database: BlastDatabases/689/689 Posted date: Apr 10, 2011 12:15 AM Number of letters in database: 1,619,870 Number of sequences in database: 4735 Lambda K H 0.309 0.123 0.318 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 4735 Number of Hits to DB: 282,313 Number of extensions: 7283 Number of successful extensions: 122 Number of sequences better than 1.0e-08: 54 Number of HSP's gapped: 120 Number of HSP's successfully gapped: 54 Length of query: 125 Length of database: 1,619,870 Length adjustment: 75 Effective length of query: 50 Effective length of database: 1,264,745 Effective search space: 63237250 Effective search space used: 63237250 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) S2: 125 (52.8 bits)