BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0174.0006.p (162 letters) Database: BlastDatabases/689/689 4735 sequences; 1,619,870 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|300311014|ref|YP_003775106.1| leucine-responsive regulatory D... 310 4e-86 gi|300309515|ref|YP_003773607.1| leucine-responsive regulatory p... 159 1e-40 gi|300312490|ref|YP_003776582.1| transcription regulator protein... 121 2e-29 gi|300310455|ref|YP_003774547.1| AsnC family transcription regul... 105 1e-24 gi|300311006|ref|YP_003775098.1| transcription regulator protein... 103 7e-24 >gi|300311014|ref|YP_003775106.1| leucine-responsive regulatory DNA-binding transcription regulator protein [Herbaspirillum seropedicae SmR1] Length = 162 Score = 310 bits (794), Expect = 4e-86, Method: Compositional matrix adjust. Identities = 150/162 (92%), Positives = 159/162 (98%) Query: 1 MRTQQLSVRTLDKLDRRILAVLQKDGRISMKDLGEQVGLSITPCIERVKRMERDGVISGY 60 MRTQQ SVRTLDKLD RILAVLQKDGRISMK+LGEQVGLS+TPCIERV+RMERDGVI+GY Sbjct: 1 MRTQQQSVRTLDKLDHRILAVLQKDGRISMKELGEQVGLSVTPCIERVRRMERDGVITGY 60 Query: 61 YARIDPATLGATLLVFVEITLNHKSGNMFEQFRREVLRIPEVQECHLVSGDFDYLIKARI 120 YAR++P +LGATLLVFVEITLNHKSGNMFEQFRREVLRIPEVQECHLVSGDFDYLIKARI Sbjct: 61 YARVNPESLGATLLVFVEITLNHKSGNMFEQFRREVLRIPEVQECHLVSGDFDYLIKARI 120 Query: 121 RGMAEYRKLLGDILLQLPGAAQSKSYVVMEEIKETLALPLEE 162 RGMAEYRKLLGDILLQLPGAAQSKSYVVMEEIKETLALPL++ Sbjct: 121 RGMAEYRKLLGDILLQLPGAAQSKSYVVMEEIKETLALPLDD 162 >gi|300309515|ref|YP_003773607.1| leucine-responsive regulatory protein [Herbaspirillum seropedicae SmR1] Length = 154 Score = 159 bits (401), Expect = 1e-40, Method: Compositional matrix adjust. Identities = 71/150 (47%), Positives = 107/150 (71%) Query: 11 LDKLDRRILAVLQKDGRISMKDLGEQVGLSITPCIERVKRMERDGVISGYYARIDPATLG 70 LDK+ ++ILA LQ DGRIS DL +V LS C+ERV++++ G I GY A+++P L Sbjct: 4 LDKISKKILAELQNDGRISNVDLAARVNLSPAACLERVRKLQEAGYILGYAAQLNPELLD 63 Query: 71 ATLLVFVEITLNHKSGNMFEQFRREVLRIPEVQECHLVSGDFDYLIKARIRGMAEYRKLL 130 +LLVF+E+ L+ + ++F +F++ V IPE+ ECH+V+G FDYL+K+R++ M YR+ L Sbjct: 64 VSLLVFIEVVLDRTTPDVFAEFKKSVQSIPEIMECHMVAGGFDYLVKSRVKDMNAYREFL 123 Query: 131 GDILLQLPGAAQSKSYVVMEEIKETLALPL 160 G LLQL G ++ +Y VMEE+K T+ LP+ Sbjct: 124 GKSLLQLKGVRETHTYAVMEEVKNTIRLPI 153 >gi|300312490|ref|YP_003776582.1| transcription regulator protein [Herbaspirillum seropedicae SmR1] Length = 153 Score = 121 bits (304), Expect = 2e-29, Method: Compositional matrix adjust. Identities = 59/152 (38%), Positives = 93/152 (61%) Query: 10 TLDKLDRRILAVLQKDGRISMKDLGEQVGLSITPCIERVKRMERDGVISGYYARIDPATL 69 +LD++D+RIL LQKDGRI +L +++G+S T C KR+ +G + A +DP L Sbjct: 2 SLDRMDKRILKALQKDGRIGNAELAKKLGMSATACWNHTKRLMEEGYVKEVRAILDPEKL 61 Query: 70 GATLLVFVEITLNHKSGNMFEQFRREVLRIPEVQECHLVSGDFDYLIKARIRGMAEYRKL 129 G +LV V + L+ + F +F + V I VQEC L++G+FDY IK R++ + + +L Sbjct: 62 GLPVLVTVGVVLDRSTPESFAEFEKAVRDIAAVQECLLLAGEFDYWIKLRVKDLQAFNRL 121 Query: 130 LGDILLQLPGAAQSKSYVVMEEIKETLALPLE 161 + LL+LPG Q +S+ V+ E+K L +E Sbjct: 122 HANTLLRLPGVRQLRSFFVLNEVKNNPELVVE 153 >gi|300310455|ref|YP_003774547.1| AsnC family transcription regulator protein [Herbaspirillum seropedicae SmR1] Length = 164 Score = 105 bits (263), Expect = 1e-24, Method: Compositional matrix adjust. Identities = 59/152 (38%), Positives = 88/152 (57%) Query: 11 LDKLDRRILAVLQKDGRISMKDLGEQVGLSITPCIERVKRMERDGVISGYYARIDPATLG 70 LD++D RIL LQ++ RI+ L + VGLS +PC+ RVKR+E+ G ISGY A I L Sbjct: 9 LDRIDLRILCHLQQNSRITNVILADAVGLSPSPCLIRVKRLEKAGYISGYGAYIRLEKLA 68 Query: 71 ATLLVFVEITLNHKSGNMFEQFRREVLRIPEVQECHLVSGDFDYLIKARIRGMAEYRKLL 130 +VF E+TL+ F +F + + E+ ECHLVSG +DYL+K R + Y+ ++ Sbjct: 69 DVQIVFTEVTLSDHRREDFAKFESTIRNVDEIIECHLVSGGYDYLLKFMTRSVVHYQSVI 128 Query: 131 GDILLQLPGAAQSKSYVVMEEIKETLALPLEE 162 +L Q + SY+V++ PLE+ Sbjct: 129 ESLLEQNLRIEKYFSYIVIKSPFVKHHYPLEK 160 >gi|300311006|ref|YP_003775098.1| transcription regulator protein [Herbaspirillum seropedicae SmR1] Length = 172 Score = 103 bits (257), Expect = 7e-24, Method: Compositional matrix adjust. Identities = 54/157 (34%), Positives = 91/157 (57%) Query: 6 LSVRTLDKLDRRILAVLQKDGRISMKDLGEQVGLSITPCIERVKRMERDGVISGYYARID 65 +S+ +D+ D +L LQ+DG I+ LG++V LS + RV+R+E VI Y A +D Sbjct: 1 MSIINVDRYDLALLTELQRDGHITNSALGQKVHLSTSQISRRVQRLEEAHVIERYTAVLD 60 Query: 66 PATLGATLLVFVEITLNHKSGNMFEQFRREVLRIPEVQECHLVSGDFDYLIKARIRGMAE 125 PA +G + F +TL+ + E F + V +PEV EC V+G+ DY+++ +A Sbjct: 61 PAVVGLGVTAFTTVTLDRQGETRGELFEKAVETMPEVTECFSVTGEGDYILRIVAPDLAA 120 Query: 126 YRKLLGDILLQLPGAAQSKSYVVMEEIKETLALPLEE 162 + + + LL+LPG KS + ++++K++ LPLE Sbjct: 121 FSEFMMTRLLRLPGVTNVKSNITLKKVKQSHELPLEH 157 Database: BlastDatabases/689/689 Posted date: Apr 10, 2011 12:15 AM Number of letters in database: 1,619,870 Number of sequences in database: 4735 Lambda K H 0.322 0.140 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 4735 Number of Hits to DB: 461,772 Number of extensions: 17587 Number of successful extensions: 75 Number of sequences better than 1.0e-08: 9 Number of HSP's gapped: 75 Number of HSP's successfully gapped: 9 Length of query: 162 Length of database: 1,619,870 Length adjustment: 78 Effective length of query: 84 Effective length of database: 1,250,540 Effective search space: 105045360 Effective search space used: 105045360 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 127 (53.5 bits)