BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0168.0059.p (115 letters) Database: BlastDatabases/689/689 4735 sequences; 1,619,870 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|300309490|ref|YP_003773582.1| branched-chain amino acid ABC t... 112 8e-27 gi|300314071|ref|YP_003778163.1| amino acid ABC transporter peri... 109 7e-26 gi|300312339|ref|YP_003776431.1| branched-chain amino acid ABC t... 98 2e-22 gi|300312372|ref|YP_003776464.1| branched-chain amino acid ABC t... 75 2e-15 >gi|300309490|ref|YP_003773582.1| branched-chain amino acid ABC transporter periplasmic protein [Herbaspirillum seropedicae SmR1] Length = 404 Score = 112 bits (280), Expect = 8e-27, Method: Composition-based stats. Identities = 53/65 (81%), Positives = 60/65 (92%) Query: 1 MLQAQASKAQILGLANAGGDTINSIKAANEFGINKTMKLAGLLMFINDVHALTLQVTQGM 60 +LQAQ+SKAQILGLA AGGD IN+IKAANEFG+NKTMKLAGLL+FIND H+L L +TQGM Sbjct: 216 LLQAQSSKAQILGLAVAGGDVINAIKAANEFGVNKTMKLAGLLIFINDTHSLGLSLTQGM 275 Query: 61 YLTDG 65 YLTDG Sbjct: 276 YLTDG 280 >gi|300314071|ref|YP_003778163.1| amino acid ABC transporter periplasmic protein [Herbaspirillum seropedicae SmR1] Length = 402 Score = 109 bits (272), Expect = 7e-26, Method: Composition-based stats. Identities = 51/64 (79%), Positives = 60/64 (93%) Query: 1 MLQAQASKAQILGLANAGGDTINSIKAANEFGINKTMKLAGLLMFINDVHALTLQVTQGM 60 +LQAQ+SKAQI+GLANAGGD INS+KAANEFGI KT KLAGLL+FINDVH+LTL+ T+G+ Sbjct: 214 LLQAQSSKAQIIGLANAGGDFINSVKAANEFGITKTAKLAGLLVFINDVHSLTLKNTEGL 273 Query: 61 YLTD 64 YLTD Sbjct: 274 YLTD 277 >gi|300312339|ref|YP_003776431.1| branched-chain amino acid ABC transporter periplasmic protein [Herbaspirillum seropedicae SmR1] Length = 404 Score = 97.8 bits (242), Expect = 2e-22, Method: Composition-based stats. Identities = 47/64 (73%), Positives = 54/64 (84%) Query: 1 MLQAQASKAQILGLANAGGDTINSIKAANEFGINKTMKLAGLLMFINDVHALTLQVTQGM 60 +LQAQASKAQILGLANAG DT+NSIKAA EFG+ KTMKL GLLM IND+HAL L +G+ Sbjct: 216 LLQAQASKAQILGLANAGEDTVNSIKAAKEFGVTKTMKLVGLLMVINDIHALGLANAEGL 275 Query: 61 YLTD 64 +TD Sbjct: 276 MMTD 279 >gi|300312372|ref|YP_003776464.1| branched-chain amino acid ABC transporter periplasmic protein [Herbaspirillum seropedicae SmR1] Length = 410 Score = 75.1 bits (183), Expect = 2e-15, Method: Composition-based stats. Identities = 35/66 (53%), Positives = 48/66 (72%), Gaps = 1/66 (1%) Query: 1 MLQAQASKAQILGLANAGGDTINSIKAANEFGI-NKTMKLAGLLMFINDVHALTLQVTQG 59 +LQAQASKAQ++GLA+ G D +N+IK A F + K +L LL+F++DVHAL L+ QG Sbjct: 220 LLQAQASKAQVIGLADGGTDVVNAIKQARSFAVGGKDQRLVALLVFLSDVHALGLEAAQG 279 Query: 60 MYLTDG 65 + TDG Sbjct: 280 LVYTDG 285 Database: BlastDatabases/689/689 Posted date: Apr 10, 2011 12:15 AM Number of letters in database: 1,619,870 Number of sequences in database: 4735 Lambda K H 0.320 0.135 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 4735 Number of Hits to DB: 340,783 Number of extensions: 11308 Number of successful extensions: 22 Number of sequences better than 1.0e-08: 4 Number of HSP's gapped: 21 Number of HSP's successfully gapped: 4 Length of query: 115 Length of database: 1,619,870 Length adjustment: 73 Effective length of query: 42 Effective length of database: 1,274,215 Effective search space: 53517030 Effective search space used: 53517030 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 124 (52.4 bits)