BLASTP 2.2.18 [Mar-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 0168.0025.p
         (78 letters)

Database: BlastDatabases/689/689 
           4735 sequences; 1,619,870 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|300310173|ref|YP_003774265.1| ATPase/kinase [Herbaspirillum s...    59   6e-11

>gi|300310173|ref|YP_003774265.1| ATPase/kinase [Herbaspirillum
          seropedicae SmR1]
          Length = 161

 Score = 59.3 bits (142), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 42/64 (65%), Gaps = 6/64 (9%)

Query: 4  SRHTHLQDEAGTAALGAALAQVLEPGMAIYLHGDLGAGKXWRSTCTATRARARAAACR-R 62
          + H HL DEA TA LGA LA+VL PG+AIYLHGDLGAGK        TRA   AA  + R
Sbjct: 3  AHHLHLPDEAATAHLGADLARVLAPGLAIYLHGDLGAGK-----TALTRALLHAAGYQGR 57

Query: 63 LRGP 66
          ++ P
Sbjct: 58 VKSP 61


  Database: BlastDatabases/689/689
    Posted date:  Apr 10, 2011 12:15 AM
  Number of letters in database: 1,619,870
  Number of sequences in database:  4735
  
Lambda     K      H
   0.321    0.131    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 4735
Number of Hits to DB: 184,123
Number of extensions: 4082
Number of successful extensions: 19
Number of sequences better than 1.0e-08: 1
Number of HSP's gapped: 19
Number of HSP's successfully gapped: 1
Length of query: 78
Length of database: 1,619,870
Length adjustment: 49
Effective length of query: 29
Effective length of database: 1,387,855
Effective search space: 40247795
Effective search space used: 40247795
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 123 (52.0 bits)