BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0159.0019.p (151 letters) Database: BlastDatabases/689/689 4735 sequences; 1,619,870 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|300310576|ref|YP_003774668.1| transcription regulator protein... 110 5e-26 gi|300311760|ref|YP_003775852.1| transcription regulator protein... 61 5e-11 gi|300313807|ref|YP_003777899.1| AraC family transcription regul... 59 2e-10 >gi|300310576|ref|YP_003774668.1| transcription regulator protein [Herbaspirillum seropedicae SmR1] Length = 255 Score = 110 bits (275), Expect = 5e-26, Method: Compositional matrix adjust. Identities = 63/149 (42%), Positives = 94/149 (63%), Gaps = 8/149 (5%) Query: 3 RLAEFIDLSLDLSRSGTAGLVLPESVVRHCTPLLLEALTA-MPQRQSRLHGLLLRIDAAP 61 +L EF+ +SL +RS A +++H PLLL+ L PQ SRL ++ +++A Sbjct: 112 KLVEFMAVSLAQARSSPA-------MLQHWVPLLLDTLAQRTPQALSRLRRMMAQVEAQV 164 Query: 62 GQAWTAARMARVANLSVSRLHALFKSELGRTPQEWLSDVRLRFVQDALAGSDVPVAELAL 121 WT A+MA A +S SRLH F++EL +P+ WL++VR+ L S +P+A++A Sbjct: 165 AHPWTVAQMAEAAAISPSRLHEWFRAELDSSPRAWLAEVRMAQACQLLRTSALPLAQVAQ 224 Query: 122 RAGYSDQSALTRAMRRTTGMTPAAYRREH 150 R GY+DQSALT AMRR G+TPA+YR+ + Sbjct: 225 RCGYADQSALTHAMRRLRGVTPASYRKNY 253 >gi|300311760|ref|YP_003775852.1| transcription regulator protein [Herbaspirillum seropedicae SmR1] Length = 319 Score = 60.8 bits (146), Expect = 5e-11, Method: Compositional matrix adjust. Identities = 33/90 (36%), Positives = 49/90 (54%) Query: 57 IDAAPGQAWTAARMARVANLSVSRLHALFKSELGRTPQEWLSDVRLRFVQDALAGSDVPV 116 + A P Q W R+ARVA LS S F+ E+G TP ++L R+ + L +D + Sbjct: 212 LHAQPAQDWNVPRLARVAALSRSSFFERFRREVGLTPMDYLLAWRMALAKRLLLRADGSI 271 Query: 117 AELALRAGYSDQSALTRAMRRTTGMTPAAY 146 AE+AL+ GYS S + A R G+ P+ + Sbjct: 272 AEVALQVGYSSASTFSVAFSRHVGLPPSQF 301 >gi|300313807|ref|YP_003777899.1| AraC family transcription regulator protein [Herbaspirillum seropedicae SmR1] Length = 299 Score = 58.5 bits (140), Expect = 2e-10, Method: Compositional matrix adjust. Identities = 30/82 (36%), Positives = 43/82 (52%) Query: 70 MARVANLSVSRLHALFKSELGRTPQEWLSDVRLRFVQDALAGSDVPVAELALRAGYSDQS 129 +AR N+S S FK+ G TP +WL R+ Q L + + +AE+AL + DQS Sbjct: 218 IARECNMSASYFLRAFKASTGHTPHQWLMVQRVEMAQQYLRSTQLTLAEIALACDFYDQS 277 Query: 130 ALTRAMRRTTGMTPAAYRREHR 151 +R + G TP A+RR R Sbjct: 278 HFSRVFSQVVGSTPGAWRRRLR 299 Database: BlastDatabases/689/689 Posted date: Apr 10, 2011 12:15 AM Number of letters in database: 1,619,870 Number of sequences in database: 4735 Lambda K H 0.323 0.132 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 4735 Number of Hits to DB: 486,816 Number of extensions: 18726 Number of successful extensions: 110 Number of sequences better than 1.0e-08: 5 Number of HSP's gapped: 114 Number of HSP's successfully gapped: 5 Length of query: 151 Length of database: 1,619,870 Length adjustment: 77 Effective length of query: 74 Effective length of database: 1,255,275 Effective search space: 92890350 Effective search space used: 92890350 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 126 (53.1 bits)